DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and NNK1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_012750.1 Gene:NNK1 / 853683 SGDID:S000001654 Length:928 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:66/320 - (20%)
Similarity:124/320 - (38%) Gaps:83/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LVISRAHFKDFPALLQGVTESLKRHVLLRSAIAHFRRTDGSHLTSLSCFRETDIVICCCKNEEII 103
            ::|..|...|:.|::     ||.:..:|.|:.::|         ||:.|.....|.....|::.|
Yeast   329 VIIEHAPSHDYKAMM-----SLVKKFMLTSSRSNF---------SLAGFANNASVSQATANDDNI 379

  Fly   104 CVKYSINKDFQRMVDSCKRWGQHHLDSGTLES---------------MKSHDL---------PEA 144
            ..:.:.|......|::.......|   |::.|               |.|:.|         |:.
Yeast   380 NSRNTPNNSNDTYVNTRPLQRSRH---GSIASQFLSSFSPSMTSIAKMNSNPLSGSAGGSARPDD 441

  Fly   145 IQLYIETIEPVEHNTRTLIYRG-----------QTRANRTKCTVKMVNKQTQSNDRGDTYMEAEV 198
                 :.:|.:.|....:|..|           :|...|   .:|:|..:...|.:.....|..:
Yeast   442 -----KGMEILGHRLGKIIGFGAWGIIRECFDIETGVGR---VIKIVKFKGHQNIKKHVLREVAI 498

  Fly   199 LRQLQSHPNIIELM-YTVEDERYMYTVLEHL-DCNMQKVI-----QKRGILSEADARSVMRC--- 253
            .|.|: |..|:.|: :.::|...||.:.|.: |..:..::     .||..:..|:     ||   
Yeast   499 WRTLK-HNRILPLLDWKLDDNYAMYCLTERINDGTLYDLVISWDEFKRSKIPFAE-----RCRLT 557

  Fly   254 ------TVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLY 307
                  .:|||.:||...::|.|||.||.|:.....|.::| |.:.:|.::.::....:|
Yeast   558 IFLSLQLLSALKYMHSKTIVHGDIKLENCLLQKEGKKSDWK-VFLCDFGMSCHFDEKHVY 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 15/68 (22%)
S_TKc 164..409 CDD:214567 39/171 (23%)
PKc_like 164..403 CDD:304357 39/171 (23%)
NNK1NP_012750.1 PKc 455..>613 CDD:270622 39/167 (23%)
PKc_like <817..864 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.