DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and IKS1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_012478.3 Gene:IKS1 / 853389 SGDID:S000003593 Length:667 Species:Saccharomyces cerevisiae


Alignment Length:141 Identity:32/141 - (22%)
Similarity:58/141 - (41%) Gaps:33/141 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWN---------------FKMVK 291
            ||.....|::|.....|..:|.:.:||||:||.|.|:.:.....|               |..:.
Yeast   322 LSTEQLVSIIRDIARGLHELHSIGLIHRDLKPSNCLLLTPFKSDNENDNVYDREHNSDEFFPSIV 386

  Fly   292 VANFDLATYYRGSKLYVRC-GTPCYMAPEMI-----------------AMSGYDYQVDSWSLGVT 338
            :.:...:.....|:|...| ||..:.||::|                 ..:.|.:..|.:|||:.
Yeast   387 IGDLGESQLEGESRLGTGCTGTLEFTAPDLIIQGRPVSSSTLPSRSSHTYNEYTFASDMYSLGMI 451

  Fly   339 LFYMLCGKMPF 349
            .::::.|::||
Yeast   452 CYFIVFGELPF 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 32/141 (23%)
PKc_like 164..403 CDD:304357 32/141 (23%)
IKS1NP_012478.3 PKc_like 173..522 CDD:419665 32/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.