DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and HAL5

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_012370.1 Gene:HAL5 / 853274 SGDID:S000003701 Length:855 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:51/239 - (21%)
Similarity:103/239 - (43%) Gaps:49/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 PNIIELMYTVEDERYMYTVLEHLDC---NMQKVIQKRGILSEA---------------------- 245
            |||::::..:|.......|:|.  |   ::..::.:..|.:|:                      
Yeast   601 PNILKILDLMEYSNSFVEVMEF--CASGDLYSLLTRNNISNESNNGSSRLIQTVKEGSGSPLHPL 663

  Fly   246 DARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGS-KLYVR 309
            :|...|:..::.:.:||...:.|.|:||||:|...:.      ::|:.:|..::.::.: :.:|.
Yeast   664 EADCFMKQLLNGVQYMHDHGIAHCDLKPENILFQPNG------LLKICDFGTSSVFQTAWEKHVH 722

  Fly   310 -----CGTPCYMAP-EMIAMSGYDYQ-VDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMS-- 365
                 .|:..|:|| |.|..:.||.: ||.||.|:....|:.|:..:..|......::.:.:|  
Yeast   723 FQSGAMGSEPYVAPEEFIRDAEYDPRLVDCWSCGIVYCTMVMGQYLWKIAIPEKDSLFKSFLSEI 787

  Fly   366 --GGPTYPKDMESVMSPEATQLIDGLLVS----DPSYRVPIAEL 403
              .|..|..:....:|.|..:|....|..    ||:.|:.|.:|
Yeast   788 KDDGQFYLFEELRHVSSELNRLRKIALYRTFQVDPTKRITIEQL 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 51/239 (21%)
PKc_like 164..403 CDD:304357 50/237 (21%)
HAL5NP_012370.1 PKc_like 509..837 CDD:419665 51/239 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.