DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and VHS1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_010533.1 Gene:VHS1 / 851834 SGDID:S000002655 Length:461 Species:Saccharomyces cerevisiae


Alignment Length:237 Identity:56/237 - (23%)
Similarity:97/237 - (40%) Gaps:38/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 YMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDCNM-QKVIQKR-----GILSEADARSVM 251
            |.|..:..::..|.||:.:...::.....:.|:::...:: ..::..|     |:|    .:.|.
Yeast   106 YKEISLHLRVHHHKNIVTIHEVLQSAVCTFIVMDYYPTDLFTSIVDNRHFVTNGLL----VKKVF 166

  Fly   252 RCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLYVRCGTPCYM 316
            ....|||.:.|:..:.|.||||||||:.:...      |.:.:|.|:|.....|..|..|:..||
Yeast   167 LQICSALNYCHEHGIYHCDIKPENLLLDTEDN------VFLCDFGLSTTSTYIKPNVCIGSSYYM 225

  Fly   317 APEMIAMSGY----------------DYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMS 365
            .||.|:..|.                ....|.||||:.|..:.|.:.|:..|.|.....|.....
Yeast   226 PPERISFDGRVSSSKSGGHKLGKVCPSCNGDLWSLGIILINLTCIRNPWLKADKTEDNTYYYFTK 290

  Fly   366 GGPTYPKDMESV--MSPEATQLIDGLLVSDPSYRVPIAELDK 405
            .    |..::.:  :|.:...|:..:|..:|..|:.:.||.|
Yeast   291 D----PNILKQILPLSDDFYSLLSKILQVNPKNRMSLQELMK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 56/237 (24%)
PKc_like 164..403 CDD:304357 53/233 (23%)
VHS1NP_010533.1 STKc_Pat1_like 11..330 CDD:270895 56/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.