DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and KIN1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_010407.1 Gene:KIN1 / 851700 SGDID:S000002529 Length:1064 Species:Saccharomyces cerevisiae


Alignment Length:285 Identity:79/285 - (27%)
Similarity:132/285 - (46%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQS------------NDRG----DTYMEAEV 198
            |.:|.|...:...:...:.|.....|.||:||:.|::            |::.    ...:|.|:
Yeast   121 EFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLERQKKLEKEI 185

  Fly   199 LR-----------QLQSHPNIIELMYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSV 250
            .|           |:..||:|..|........:.|.:.|::...  :..:|| .|.:.|..||..
Yeast   186 SRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQ-HGSIREHQARKF 249

  Fly   251 MRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSK-LYVRCGTPC 314
            .|...|||.::|...::|||:|.||:::..||      .:|:.:|.|:..|...| |:..||:..
Yeast   250 ARGIASALIYLHANNIVHRDLKIENIMISDSS------EIKIIDFGLSNIYDSRKQLHTFCGSLY 308

  Fly   315 YMAPEMIAMSGY-DYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVM 378
            :.|||::..:.| ..:||.||.||.||.::|||:||..  :||..::..|..|...||:.    :
Yeast   309 FAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDD--ENSSVLHEKIKQGKVEYPQH----L 367

  Fly   379 SPEATQLIDGLLVSDPSYRVPIAEL 403
            |.|...|:..:||.||..|..:.::
Yeast   368 SIEVISLLSKMLVVDPKRRATLKQV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 76/271 (28%)
PKc_like 164..403 CDD:304357 76/269 (28%)
KIN1NP_010407.1 STKc_Kin1_2 118..398 CDD:270979 79/285 (28%)
MARK_C_like 890..1062 CDD:213377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.