DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and DUN1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_010182.1 Gene:DUN1 / 851457 SGDID:S000002259 Length:513 Species:Saccharomyces cerevisiae


Alignment Length:269 Identity:78/269 - (28%)
Similarity:134/269 - (49%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYM--EAEVLRQLQSHPNIIELMYTV-----EDER 219
            |:...:.:....:..||:.:.|...:.:.:...  |..:|.::| ||||:.|:.:.     :.:.
Yeast   213 LVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQ-HPNIVNLLDSFVEPISKSQI 276

  Fly   220 YMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSS 282
            ..|.|||.:|..  .:::::|. .|.:.:::::.:..::.|.::|:..:|||||||||:|:..:.
Yeast   277 QKYLVLEKIDDGELFERIVRKT-CLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITR 340

  Fly   283 ---------GKWNFK----MVKVANFDLATYYRGSKLYVR--CGTPCYMAPEMIAMSGYDYQVDS 332
                     |.|:..    .||:|:|.||. :.|...:..  ||||.|:|||::...||..:||.
Yeast   341 RENPSQVQLGPWDEDEIDIQVKIADFGLAK-FTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDL 404

  Fly   333 WSLGVTLFYMLCGKMPFASAC--KNSKE--IYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSD 393
            ||.||.|:..|||..||:...  .:.||  :.|......|.:.|..:||:     .||..|||.:
Yeast   405 WSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVL-----HLISNLLVLN 464

  Fly   394 PSYRVPIAE 402
            |..|..|.|
Yeast   465 PDERYNIDE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 77/267 (29%)
PKc_like 164..403 CDD:304357 77/267 (29%)
DUN1NP_010182.1 FHA 36..136 CDD:238017
STKc_CAMK 199..479 CDD:270687 78/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.