DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and RCK2

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_013349.1 Gene:RCK2 / 850950 SGDID:S000004238 Length:610 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:75/284 - (26%)
Similarity:112/284 - (39%) Gaps:53/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NRTKCTVKMVNKQTQSNDRGD------------TYMEAEVLRQLQSH-------PNIIELMYTVE 216
            |.....:|::.|...|:..||            |....:||:::..|       ..|:..:...|
Yeast   194 NYKAVAIKVIKKADLSSINGDHRKKDKGKDSTKTSSRDQVLKEVALHKTVSAGCSQIVAFIDFQE 258

  Fly   217 DERYMYTVLEHL-DCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLL--- 277
            .:.|.|.:.|.| ...:...|.:....||..:|.|::....|:.|||.|.|:||||||||||   
Yeast   259 TDSYYYIIQELLTGGEIFGEIVRLTYFSEDLSRHVIKQLALAVKHMHSLGVVHRDIKPENLLFEP 323

  Fly   278 -------------------------VCSSSGKWNFKMVKVANFDLATYYRGSKLYVRCGTPCYMA 317
                                     .....|.....:||:|:|.|:...........|||..|.|
Yeast   324 IEFTRSIKPKLRKSDDPQTKADEGIFTPGVGGGGIGIVKLADFGLSKQIFSKNTKTPCGTVGYTA 388

  Fly   318 PEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEA 382
            ||::....|..:||.|.:|..|:.||||..||..  :....:...|..|..|:.|.....:|..|
Yeast   389 PEVVKDEHYSMKVDMWGIGCVLYTMLCGFPPFYD--EKIDTLTEKISRGEYTFLKPWWDEISAGA 451

  Fly   383 TQLIDGLLVSDPSYRVPIAELDKF 406
            ...:..||..:||.|.   ::|:|
Yeast   452 KNAVAKLLELEPSKRY---DIDQF 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 75/284 (26%)
PKc_like 164..403 CDD:304357 73/279 (26%)
RCK2NP_013349.1 STKc_RCK1-like 161..478 CDD:270998 75/284 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.