DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and KIN2

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_013197.1 Gene:KIN2 / 850785 SGDID:S000004086 Length:1147 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:86/328 - (26%)
Similarity:148/328 - (45%) Gaps:56/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VKYSINKDFQRMVDSCKRWGQHHLDSGTLESMKSHDLPEAIQLYIETIEPVEHNTRTLIYRGQTR 169
            :|....:..||..|:.:       .:|.:|..:.|........::||:.........|:...|| 
Yeast    65 IKQGKEQAAQRQNDASR-------PNGAVELRQFHRRSLGDWEFLETVGAGSMGKVKLVKHRQT- 121

  Fly   170 ANRTKCTVKMVNKQTQS------------ND----RGDTYMEAEVLR-----------QLQSHPN 207
              :..|.:|:||:.:::            |:    .....:|.|:.|           |:..||:
Yeast   122 --KEICVIKIVNRASKAYLHKQHSLPSPKNESEILERQKRLEKEIARDKRTVREASLGQILYHPH 184

  Fly   208 IIELMYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRD 270
            |..|........:.|.:.|::...  :..:|| .|.|.|..||...|...|||.::|...::|||
Yeast   185 ICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQ-HGSLKEHHARKFARGIASALQYLHANNIVHRD 248

  Fly   271 IKPENLLVCSSSGKWNFKMVKVANFDLATY--YRGSKLYVRCGTPCYMAPEMIAMSGY-DYQVDS 332
            :|.||::: ||||:     :|:.:|.|:..  || .:|:..||:..:.|||::....| ..:||.
Yeast   249 LKIENIMI-SSSGE-----IKIIDFGLSNIFDYR-KQLHTFCGSLYFAAPELLKAQPYTGPEVDI 306

  Fly   333 WSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYR 397
            ||.|:.|:.::|||:||..  :||..::..|..|...||    |.:|.|...|:..::|.||..|
Yeast   307 WSFGIVLYVLVCGKVPFDD--ENSSILHEKIKKGKVDYP----SHLSIEVISLLTRMIVVDPLRR 365

  Fly   398 VPI 400
            ..:
Yeast   366 ATL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 1/2 (50%)
S_TKc 164..409 CDD:214567 76/269 (28%)
PKc_like 164..403 CDD:304357 76/269 (28%)
KIN2NP_013197.1 STKc_Kin1_2 97..377 CDD:270979 79/289 (27%)
KA1 1104..1147 CDD:396635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.