DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and CMK1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_116669.1 Gene:CMK1 / 850568 SGDID:S000001910 Length:446 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:80/282 - (28%)
Similarity:132/282 - (46%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 IEPVEHNTRTLIYRGQT----------RANRTK----CTVKMVNKQTQSNDRGD---TYMEAEVL 199
            ::|..:..:.....|:|          :|..|:    ..||::.|:....::..   .|.|.::|
Yeast    26 VQPASYVNKKKYVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDIL 90

  Fly   200 RQLQSHPNIIEL--MYTVEDERYMYTVL----EHLDCNMQKVIQKRGILSEADARSVMRCTVSAL 258
            ::|. ||||:..  .:..:|:.|:.|.|    |..|     .|.|:|..:|.||..::...:||:
Yeast    91 QRLH-HPNIVAFKDWFESKDKFYIITQLAKGGELFD-----RILKKGKFTEEDAVRILVEILSAV 149

  Fly   259 AHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSK--LYVRCGTPCYMAPEMI 321
            .:||...::|||:||||||....|.:   ..:.||:|.:|...:..:  ||...|:..|:|||::
Yeast   150 KYMHSQNIVHRDLKPENLLYIDKSDE---SPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVL 211

  Fly   322 AMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDM-----ESVMSPE 381
            ...|:....|.||:||..:.:|||...|.:  :..::......:|  .||...     :|| |.:
Yeast   212 TQDGHGKPCDIWSIGVITYTLLCGYSAFRA--ERVQDFLDECTTG--EYPVKFHRPYWDSV-SNK 271

  Fly   382 ATQLIDGLLVSDPSYRVPIAEL 403
            |.|.|...|..|||.|...|||
Yeast   272 AKQFILKALNLDPSKRPTAAEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 79/270 (29%)
PKc_like 164..403 CDD:304357 77/268 (29%)
CMK1NP_116669.1 STKc_CAMK 36..298 CDD:270687 79/272 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.