DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and camk1b

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_021335371.1 Gene:camk1b / 794026 ZFINID:ZDB-GENE-141014-1 Length:394 Species:Danio rerio


Alignment Length:264 Identity:71/264 - (26%)
Similarity:126/264 - (47%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 HDLPEAI--QLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQ 201
            :|..|.:  ..:.|.:...|..||.|:            .||.:.|:...........|..||.:
Zfish    33 YDFKEVLGTGAFSEVMLAEEKRTRKLV------------AVKCIAKKALEGKENSIENEIAVLHK 85

  Fly   202 LQSHPNIIELMYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQL 264
            :: |.||:.|....|.:.::|.|::.:...  ..::::| |..:|.||..:::..:.|:.::|.:
Zfish    86 IK-HANIVSLEDIFESKSHLYLVMQLVSGGELFDRIVEK-GFYTEKDASKLIQQILDAVKYLHDM 148

  Fly   265 QVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYY-RGSKLYVRCGTPCYMAPEMIAMSGYDY 328
            .::|||:||||||..|...:   ..:.:::|.|:... .||.:...||||.|:|||::|...|..
Zfish   149 GIVHRDLKPENLLYYSMDEE---SKIMISDFGLSKIEGSGSVMSTACGTPGYVAPEVLAQKPYSK 210

  Fly   329 QVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSD 393
            .||.||:||..:.:|||..||..  :|..:::..|:.....:.......:|..|...|..|:..|
Zfish   211 AVDCWSIGVIAYILLCGYPPFYD--ENDAKLFEQILRAEYEFDSPYWDDISDSAKDFIVHLMEKD 273

  Fly   394 PSYR 397
            |:.|
Zfish   274 PNQR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 64/237 (27%)
PKc_like 164..403 CDD:304357 64/237 (27%)
camk1bXP_021335371.1 PKc_like 29..291 CDD:328722 71/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.