DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and camk1db

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001074127.2 Gene:camk1db / 791176 ZFINID:ZDB-GENE-070112-1872 Length:392 Species:Danio rerio


Alignment Length:254 Identity:70/254 - (27%)
Similarity:120/254 - (47%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 QTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDCN 231
            |.:|......||.:.|:...........|..|||::: |.||:.|....|...::|.:       
Zfish    42 QEKATGDMYAVKCIPKKALRGKESGIENEIAVLRKIK-HENIVALEDIYESPSHLYLI------- 98

  Fly   232 MQKV--------IQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFK 288
            ||.|        |.:||..:|.||.::::..:.|:.::|.|.::|||:||||||..:...:   .
Zfish    99 MQLVSGGELFDRIVERGFYTEQDASALIKQVLDAVNYLHSLGIVHRDLKPENLLYFNPHEE---S 160

  Fly   289 MVKVANFDLATYYRGSK--LYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFAS 351
            .:.:::|.|:.....:.  :...||||.|:|||::|...|...||.||:||..:.:|||..||..
Zfish   161 KIMISDFGLSKMEGAANDIMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYD 225

  Fly   352 ACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFLA 410
              :|..:::..|:.....:.......:|..|...|:.|:..||..|....|..:..::|
Zfish   226 --ENDSKLFEQILKAEYEFDSPYWDDISDSAKDFINNLMQKDPEKRFTCDEALRHPWIA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 69/251 (27%)
PKc_like 164..403 CDD:304357 68/245 (28%)
camk1dbNP_001074127.2 STKc_CaMKI 20..280 CDD:270985 69/250 (28%)
S_TKc 24..281 CDD:214567 69/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.