DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Dapk1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_036014050.1 Gene:Dapk1 / 69635 MGIID:1916885 Length:1464 Species:Mus musculus


Alignment Length:243 Identity:66/243 - (27%)
Similarity:120/243 - (49%) Gaps:17/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 RTKCT-----VKMVNK-QTQSNDRG----DTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLE 226
            |.|.|     .|.:.| :|:|:.||    |...|..:|:::: |||:|.|....|::..:..:||
Mouse    53 REKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEIR-HPNVITLHEVYENKTDVILILE 116

  Fly   227 HL-DCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMV 290
            .: ...:...:.::..|:|.:|...::..:|.:.::|.||:.|.|:||||:::...:..  ...:
Mouse   117 LVAGGELFDFLAEKESLTEEEATEFLKQILSGVYYLHSLQIAHFDLKPENIMLLDRNVP--KPRI 179

  Fly   291 KVANFDLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACK 354
            |:.:|.||.... |::.....|||.::|||::.......:.|.||:||..:.:|.|..||....|
Mouse   180 KIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTK 244

  Fly   355 NSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAE 402
              :|..|.:.:....:.::.....|..|...|..|||.||..|:.|.:
Mouse   245 --QETLANVSAVNYDFEEEFFRNTSTLAKDFIRRLLVKDPKKRMTIQD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 66/243 (27%)
PKc_like 164..403 CDD:304357 66/243 (27%)
Dapk1XP_036014050.1 PKc_like 35..297 CDD:419665 66/243 (27%)
Ank_2 <360..431 CDD:423045
ANK repeat 400..431 CDD:293786
Ank_4 401..453 CDD:372654
ANK repeat 434..464 CDD:293786
Ank_2 450..>661 CDD:423045
ANK repeat 466..497 CDD:293786
ANK repeat 499..530 CDD:293786
ANK repeat 532..563 CDD:293786
PLN03192 <537..790 CDD:215625
ANK repeat 565..596 CDD:293786
ANK repeat 598..629 CDD:293786
ANK repeat 631..660 CDD:293786
Death_DAPK1 1330..1415 CDD:260052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.