powered by:
Protein Alignment CG10177 and RGD1565323
DIOPT Version :9
Sequence 1: | NP_651150.1 |
Gene: | CG10177 / 42772 |
FlyBaseID: | FBgn0039083 |
Length: | 411 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001103105.1 |
Gene: | RGD1565323 / 691300 |
RGDID: | 1565323 |
Length: | 121 |
Species: | Rattus norvegicus |
Alignment Length: | 72 |
Identity: | 19/72 - (26%) |
Similarity: | 28/72 - (38%) |
Gaps: | 14/72 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 224 VLEHLDCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFK 288
||:..||.:....:..|..|.....|::|.|.|.| :..:.|.:..|.||. .
Rat 11 VLKSHDCVLIYKSETEGDESPTPDSSLIRLTTSML----------KVKRLEEISSCHSSN----P 61
Fly 289 MVKVANF 295
:.|||.|
Rat 62 LEKVAFF 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10177 | NP_651150.1 |
DCX |
18..108 |
CDD:214711 |
|
S_TKc |
164..409 |
CDD:214567 |
19/72 (26%) |
PKc_like |
164..403 |
CDD:304357 |
19/72 (26%) |
RGD1565323 | NP_001103105.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0032 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.