DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Stk33

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_008758045.2 Gene:Stk33 / 690861 RGDID:1590972 Length:508 Species:Rattus norvegicus


Alignment Length:258 Identity:83/258 - (32%)
Similarity:139/258 - (53%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEV-LRQLQSHPNIIELMYTVEDERYMYTVL 225
            ::.....:....|..:|.|||: ::.......:|.|| :.:...|.:||.|....|..:.||.|:
  Rat   125 MVIEATDKETGAKWAIKKVNKE-KAGSSAVKLLEREVNILKTVKHQHIIHLEQVFESPQKMYLVM 188

  Fly   226 EHL-DCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKM 289
            |.. |..:::|:.:||..||::.|.:::...||:|::|...::|||:|.||::|.||....|.:|
  Rat   189 ELCEDGELKEVLDQRGHFSESETRLIIQSLASAIAYLHSKDIVHRDLKLENIMVKSSFIDDNNEM 253

  Fly   290 ---VKVANFDLATYYRGSK----LYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKM 347
               :||::|.||....||:    :...||||.|||||:|....|..|.|.||:||.::.:|||:.
  Rat   254 NLNIKVSDFGLAVQKHGSRSESMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMYILLCGEP 318

  Fly   348 PFASACKNSKE-IYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFL 409
            ||.:   ||:| ::..|..|...:...:...:|..|...:..|:..||::|:...||...|:|
  Rat   319 PFLA---NSEEKLFELIRKGELQFQDPVWDSVSDSAKSALKQLMKVDPAHRITAKELLDNQWL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 82/254 (32%)
PKc_like 164..403 CDD:304357 79/248 (32%)
Stk33XP_008758045.2 PKc_like 110..378 CDD:419665 82/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44167
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.