DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and STK33

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001275990.1 Gene:STK33 / 65975 HGNCID:14568 Length:514 Species:Homo sapiens


Alignment Length:374 Identity:96/374 - (25%)
Similarity:174/374 - (46%) Gaps:73/374 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VICCCKNE----EIICVKYS---------------------INKDFQRMVD------------SC 120
            |:|.|.::    .::.|:.|                     ||:|.....|            |.
Human    24 VLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVERKASQ 88

  Fly   121 KRWGQHHLDSGTLESMKSHDLPEAIQLYIE---TIEPVEHNTRTL-------IYRGQTRANRTKC 175
            ::||:.:...|.:..::           ||   .||.:....|.|       :.....:...||.
Human    89 QQWGRGNFTEGKVPHIR-----------IENGAAIEEIYTFGRILGKGSFGIVIEATDKETETKW 142

  Fly   176 TVKMVNKQTQSNDRGDTYMEAEV--LRQLQSHPNIIELMYTVEDERYMYTVLEHL-DCNMQKVIQ 237
            .:|.|||: ::.......:|.||  |:.:: |.:||.|....|..:.||.|:|.. |..:::::.
Human   143 AIKKVNKE-KAGSSAVKLLEREVNILKSVK-HEHIIHLEQVFETPKKMYLVMELCEDGELKEILD 205

  Fly   238 KRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSS----SGKWNFKMVKVANFDLA 298
            ::|..||.:.|.:::...||:|::|...::|||:|.||::|.||    :.:.|.. :||.:|.||
Human   206 RKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLKLENIMVKSSLIDDNNEINLN-IKVTDFGLA 269

  Fly   299 TYYRG---SKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIY 360
            ...:.   :.|...||||.|||||:|:...|..|.|.||:||.::.:|.|:.||.::  :.::::
Human   270 VKKQSRSEAMLQATCGTPIYMAPEVISAHDYSQQCDIWSIGVVMYMLLRGEPPFLAS--SEEKLF 332

  Fly   361 AAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFL 409
            ..|..|...:...:.:.:|..|..::..|:..||::|:...||...|:|
Human   333 ELIRKGELHFENAVWNSISDCAKSVLKQLMKVDPAHRITAKELLDNQWL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 4/18 (22%)
S_TKc 164..409 CDD:214567 76/254 (30%)
PKc_like 164..403 CDD:304357 73/248 (29%)
STK33NP_001275990.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..91 5/25 (20%)
STKc_STK33 114..381 CDD:270999 78/271 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..468
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..514
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.