DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and CAMK1G

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_065172.1 Gene:CAMK1G / 57172 HGNCID:14585 Length:476 Species:Homo sapiens


Alignment Length:217 Identity:70/217 - (32%)
Similarity:113/217 - (52%) Gaps:23/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 DTYMEAE--VLRQLQSHPNIIELMYTVEDERYMYTVLEHLDCNMQKV--------IQKRGILSEA 245
            |:.:|.|  ||:::: |.||:    |:||   :|....|....||.|        |.:||:.:|.
Human    62 DSSLENEIAVLKKIK-HENIV----TLED---IYESTTHYYLVMQLVSGGELFDRILERGVYTEK 118

  Fly   246 DARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLYVRC 310
            ||..|::..:||:.::|:..::|||:||||||..:.  :.|.| :.:.:|.|:...:...:...|
Human   119 DASLVIQQVLSAVKYLHENGIVHRDLKPENLLYLTP--EENSK-IMITDFGLSKMEQNGIMSTAC 180

  Fly   311 GTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDME 375
            |||.|:|||::|...|...||.||:||..:.:|||..||..  :...:::..|..|...:.....
Human   181 GTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLCGYPPFYE--ETESKLFEKIKEGYYEFESPFW 243

  Fly   376 SVMSPEATQLIDGLLVSDPSYR 397
            ..:|..|...|..||..||:.|
Human   244 DDISESAKDFICHLLEKDPNER 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 70/217 (32%)
PKc_like 164..403 CDD:304357 70/217 (32%)
CAMK1GNP_065172.1 STKc_CaMKI_gamma 19..303 CDD:271068 70/217 (32%)
Autoinhibitory domain. /evidence=ECO:0000250 277..317
Calmodulin-binding. /evidence=ECO:0000250 297..318
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..352
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.