DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and dapk3

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_690685.1 Gene:dapk3 / 562194 ZFINID:ZDB-GENE-030131-3026 Length:453 Species:Danio rerio


Alignment Length:267 Identity:63/267 - (23%)
Similarity:129/267 - (48%) Gaps:12/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 EAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSN-----DRGDTYMEAEVLRQL 202
            |.:::|.:..|.:......::.:.:.:::.|:...|.:.|:..|:     .|.:...|..:||::
Zfish     7 EDVEIYYDMGEELGSGQFAIVRKCKEKSSGTEYAAKFIKKRRLSSSRRGVSREEIEREVNILREI 71

  Fly   203 QSHPNIIELMYTVEDERYMYTVLEHLD-CNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQV 266
            | |.|||.|....|::..:..:||.:. ..:...:.::..|:|.:|...::..:..:.::|..::
Zfish    72 Q-HSNIITLHDIFENKTDVILILELVSGGELFDFLAEKESLTEEEATQFLKQILDGVHYLHSKRI 135

  Fly   267 IHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQV 330
            .|.|:||||:::...:..  ...:|:.:|.:|...: |::.....|||.::|||::.......:.
Zfish   136 AHFDLKPENIMLLDKNVP--NPRIKLIDFGIAHQIKDGNEFKNIFGTPEFVAPEIVNYEPLGLEA 198

  Fly   331 DSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPS 395
            |.||:||..:.:|.|..||....|  :|....|.:....:.::..|..|..|...|..|||.||.
Zfish   199 DMWSIGVITYILLSGASPFLGETK--QETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPK 261

  Fly   396 YRVPIAE 402
            .|:.|.:
Zfish   262 KRMTIED 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 60/246 (24%)
PKc_like 164..403 CDD:304357 60/246 (24%)
dapk3XP_690685.1 STKc_DAPK 7..275 CDD:271007 63/267 (24%)
S_TKc 13..275 CDD:214567 61/261 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.