DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and mylk3

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001099057.1 Gene:mylk3 / 561635 ZFINID:ZDB-GENE-030131-3497 Length:715 Species:Danio rerio


Alignment Length:339 Identity:87/339 - (25%)
Similarity:150/339 - (44%) Gaps:36/339 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ETDIVICCCKNEEIICVKYSINKDFQRMVDSCKRWGQHHL---DSGTLESMKSHDLPEAIQLYIE 150
            |:|.::.|..:.:    ..|:::|.:......::.....|   ||..|.:...|.:..|.|:.|.
Zfish   339 ESDKIMICAVSPQ----NTSLDEDEKSKAAPLRKVESTLLIIDDSPPLPAPFDHRIVSAKQVPIN 399

  Fly   151 T---IEPVEHNTRTLIYRGQTRANRTKC---------TVKMVNKQTQSNDRGDTYMEAEVLRQLQ 203
            :   :.|||      :..|.......||         ..|:: |.....:|.:...|..|:.|| 
Zfish   400 SYYAVNPVE------VLGGGRFGQVHKCAELSSGLTLAAKII-KVRGMKERDEVKNEIGVMNQL- 456

  Fly   204 SHPNIIELMYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQV 266
            :|.|:|:|....|....:..::|:::..  .:::|.:...|:|.||....|.....:.::||..:
Zfish   457 NHVNLIQLYDAFESRTNLTLIMEYVEGGELFERIIDESYQLTELDAIVFTRQICEGVQYLHQQYI 521

  Fly   267 IHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQV 330
            :|.|:||||:|..:|:|    ..:|:.:|.||..|| ..||.|..|||.::|||::......:..
Zfish   522 LHLDLKPENILCVNSTG----NQIKIIDFGLARKYRPREKLKVNFGTPEFLAPEVVNYDFVSFPT 582

  Fly   331 DSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPS 395
            |.||:||..:.:|.|..||..  .|..|....|:.....:..:....:|.||...|..||||...
Zfish   583 DMWSVGVITYMLLSGLSPFMG--DNDAETMNNILHAKWEFDTEAFENVSEEAKDFISSLLVSAKC 645

  Fly   396 YRVPIAELDKFQFL 409
            .|:..:...|..:|
Zfish   646 SRLSASGCMKHSWL 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 3/18 (17%)
S_TKc 164..409 CDD:214567 70/256 (27%)
PKc_like 164..403 CDD:304357 69/250 (28%)
mylk3NP_001099057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..114
STKc_MLCK3 399..659 CDD:271094 73/273 (27%)
S_TKc 407..659 CDD:214567 72/265 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.