Sequence 1: | NP_651150.1 | Gene: | CG10177 / 42772 | FlyBaseID: | FBgn0039083 | Length: | 411 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093460.1 | Gene: | dapk1 / 558314 | ZFINID: | ZDB-GENE-060526-177 | Length: | 1439 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 68/272 - (25%) |
---|---|---|---|
Similarity: | 133/272 - (48%) | Gaps: | 14/272 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 EAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNK-QTQSNDRG----DTYMEAEVLRQL 202
Fly 203 QSHPNIIELMYTVEDERYMYTVLEHL-DCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQV 266
Fly 267 IHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQV 330
Fly 331 DSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPS 395
Fly 396 YRVPIAELDKFQ 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10177 | NP_651150.1 | DCX | 18..108 | CDD:214711 | |
S_TKc | 164..409 | CDD:214567 | 65/251 (26%) | ||
PKc_like | 164..403 | CDD:304357 | 62/245 (25%) | ||
dapk1 | NP_001093460.1 | STKc_DAPK1 | 7..275 | CDD:271096 | 68/272 (25%) |
S_TKc | 13..275 | CDD:214567 | 66/266 (25%) | ||
Ank_2 | <337..409 | CDD:289560 | |||
ANK | 373..497 | CDD:238125 | |||
ANK repeat | 378..409 | CDD:293786 | |||
Ank_4 | 379..432 | CDD:290365 | |||
ANK repeat | 412..442 | CDD:293786 | |||
Ank_2 | 416..508 | CDD:289560 | |||
ANK | 439..564 | CDD:238125 | |||
ANK repeat | 444..475 | CDD:293786 | |||
ANK repeat | 477..508 | CDD:293786 | |||
ANK | 505..629 | CDD:238125 | |||
ANK repeat | 510..541 | CDD:293786 | |||
Ank_4 | 513..564 | CDD:290365 | |||
ANK repeat | 543..574 | CDD:293786 | |||
Ank_2 | 548..635 | CDD:289560 | |||
ANK repeat | 576..607 | CDD:293786 | |||
ANK | 604..>671 | CDD:238125 | |||
ANK repeat | 609..638 | CDD:293786 | |||
Ank_4 | 610..662 | CDD:290365 | |||
Death_DAPK1 | 1310..1399 | CDD:260052 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |