DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and mylk4b

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_021324306.1 Gene:mylk4b / 449707 ZFINID:ZDB-GENE-041001-128 Length:697 Species:Danio rerio


Alignment Length:312 Identity:81/312 - (25%)
Similarity:149/312 - (47%) Gaps:28/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KDFQRMVDSCKRWGQHHLDSG---------TLESMKSHDLPEAIQLYIETIEPVEHNTRTLIYRG 166
            ||.:.:.|      ::.:||.         .|.|.|:|.:.....:..|  |.:......::::.
Zfish   377 KDAEAVTD------EYVIDSSPPPPAPFEHRLVSTKTHQITSYYNINKE--EVLGGGRFGIVHKC 433

  Fly   167 QTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDCN 231
            :.:::......|::..::| .::.....|.||:.|| :|.|:|:|....|....:..|:|::|..
Zfish   434 EEKSSGLILAAKIIKARSQ-KEKEVVKCEIEVMNQL-NHANLIQLYAAFESRHEITLVMEYVDGG 496

  Fly   232 --MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVAN 294
              .:::|.:...|:|.|....:|.....|.:||::.::|.|:||||:|..|.    ....||:.:
Zfish   497 ELFERIIDENYKLTELDTVLFIRQITEGLQYMHKMYILHLDLKPENILCISR----ETNKVKIID 557

  Fly   295 FDLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKE 358
            |.||..|: ..||.|..|||.::|||:|......:..|.|||||..:.:|.|..||..  ::..|
Zfish   558 FGLARRYKPREKLRVNFGTPEFLAPEVINYEFVSFPTDMWSLGVITYMLLSGLSPFLG--EDDNE 620

  Fly   359 IYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFLA 410
            ....|::...::.:...:.:|.||...|..|||...|:|:..::..|..:|:
Zfish   621 TLNNILACQWSFEEAEFADISEEAKDFISRLLVKSKSWRMSASQSLKHPWLS 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 69/247 (28%)
PKc_like 164..403 CDD:304357 68/241 (28%)
mylk4bXP_021324306.1 STKc_MLCK4 411..671 CDD:271095 71/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.