DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Nuak1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001369005.1 Gene:Nuak1 / 41256 FlyBaseID:FBgn0262617 Length:2803 Species:Drosophila melanogaster


Alignment Length:308 Identity:87/308 - (28%)
Similarity:136/308 - (44%) Gaps:71/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KDFQRMVDSCKRWGQHHLDSGTLESMKSHDLPEAIQLYIETIEPVEHNTRTLIYRGQTRANRT-- 173
            |..::..|..|:.||     ||...         :||.|        |..|    ||..|.:|  
  Fly    64 KKLRQRFDIIKKLGQ-----GTYGK---------VQLGI--------NKET----GQEVAIKTIK 102

  Fly   174 KCTVKMVNKQTQSNDRGDTYMEAEVLR-----QLQS---HPNIIELMYTVEDERYMYTVLEH-LD 229
            ||.::               .||:::|     |:.|   |||||.:....|:...|..|:|. ..
  Fly   103 KCKIE---------------AEADLVRIRREVQIMSSVHHPNIIHIYEVFENREKMVLVMEFAAG 152

  Fly   230 CNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVAN 294
            ..:...:.:|.:|:|.:||.:.|...:|:.:.|:.::.|||:|.||:|:   ..|.|   .|:|:
  Fly   153 GELYDYLSERKVLTEEEARRIFRQVATAVYYCHKHKICHRDLKLENILL---DEKGN---AKIAD 211

  Fly   295 FDLATYYRGSKLY-VRCGTPCYMAPEMIAMSGYDYQ---VDSWSLGVTLFYMLCGKMPFASACKN 355
            |.|:..:...:|. ..||:|.|.:||::  .|..||   ||.|||||.|:.::.|.|||..:  |
  Fly   212 FGLSNVFDDQRLLGTFCGSPLYASPEIV--EGTPYQGPEVDCWSLGVLLYTLVYGSMPFDGS--N 272

  Fly   356 SKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAEL 403
            .|.:...|..|....|:     ....|:.||..:|...|..|..|.::
  Fly   273 FKRLVKQISQGDYYEPR-----KPSRASTLIRDMLTVCPRKRASIEQI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 75/255 (29%)
PKc_like 164..403 CDD:304357 75/253 (30%)
Nuak1NP_001369005.1 STKc_NUAK 68..321 CDD:270975 86/304 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.