DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and camk1gb

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_021325441.1 Gene:camk1gb / 393802 ZFINID:ZDB-GENE-040426-1694 Length:486 Species:Danio rerio


Alignment Length:335 Identity:92/335 - (27%)
Similarity:150/335 - (44%) Gaps:64/335 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IVIC-CCKNEEIICVKYSINKDFQRMVDS-CKR----WG---------QHHLDSGTLES----MK 137
            :::| ||.     |::          :|| |||    |.         :.|.:.|..|.    .|
Zfish    16 VILCHCCP-----CLR----------LDSFCKRQKSCWSCYRPEEIPVEAHAEMGRKEGEYEWKK 65

  Fly   138 SHDLPEAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAE--VLR 200
            |.|   .||...:.::.:.....:.::..:.|.......:|.|.|:    ::.|..:|.|  |||
Zfish    66 STD---NIQDVFDFMDVLGSGAFSEVFMVKERKTGKLFAMKCVKKK----NKRDINLENEIAVLR 123

  Fly   201 QLQSHPNIIELMYTVEDERYMYTVLEHLDCNMQKV--------IQKRGILSEADARSVMRCTVSA 257
            ::: |.|::.|....|...:.|.|       ||.|        |..||:.||.||.||:|..:.|
Zfish   124 KIK-HENVVCLEDFYESRTHYYLV-------MQLVSGGELFDRILDRGMYSEMDASSVIRQVLEA 180

  Fly   258 LAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLYVRCGTPCYMAPEMIA 322
            ::::|...::|||:||||||..|...  |.| :.:::|.|:.......:...||||.|:|||::|
Zfish   181 VSYLHNNGIVHRDLKPENLLYYSPDE--NSK-IMISDFGLSKMEDNGVMSTACGTPGYVAPEVLA 242

  Fly   323 MSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLID 387
            ...|...||.||:||..:.:|||..||..  :....:::.||.|...:.......:|..|...|.
Zfish   243 QKPYSKAVDCWSIGVITYILLCGYPPFYE--ETETRLFSKIMKGQYEFDSPFWDDISESAKDFIR 305

  Fly   388 GLLVSDPSYR 397
            .::..:|..|
Zfish   306 NMMQKNPKMR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 4/16 (25%)
S_TKc 164..409 CDD:214567 74/244 (30%)
PKc_like 164..403 CDD:304357 74/244 (30%)
camk1gbXP_021325441.1 PKc_like 70..353 CDD:328722 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.