DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and stk17b

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_956829.1 Gene:stk17b / 393507 ZFINID:ZDB-GENE-040426-1499 Length:354 Species:Danio rerio


Alignment Length:299 Identity:73/299 - (24%)
Similarity:128/299 - (42%) Gaps:28/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QRMVDSCKRWGQHHLDSGTLESMKSHDLPEAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVK 178
            :|.:||  |.|    .|..|..:.||...:.:....:..:.:......::.|...:........|
Zfish     3 RRRLDS--RSG----SSALLSEIHSHIHTDPLDTLFDIGKELGRGKFAVVKRCVEKTTGKVFAAK 61

  Fly   179 MVNKQTQSND-RGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHL-------DCNMQKV 235
            .:.|:.:..| |.|...|..||...:::|.::.|....|.:..:..:||..       .|...: 
Zfish    62 FIKKRRRGRDCRADVIHEIAVLEAAKNNPRVVNLNAVYETDYDLVLMLEFAAGGEIFNHCVSDE- 125

  Fly   236 IQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATY 300
                 :|.|.....::|..:..:..:||..|:|.|:||:|:|:.|.|...:   :|:.:|.||..
Zfish   126 -----LLPEGQITRLIRQMLEGIHLLHQSSVVHLDLKPQNILLTSLSPLGD---IKIVDFGLARR 182

  Fly   301 YRGSKLYVR--CGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAI 363
            . ||...:|  .|||.|:|||::.........|.||:||..:.::.|:.|||.  .:.:|.:..:
Zfish   183 L-GSAGELREILGTPEYVAPEILNYEPITTATDLWSVGVITYMLVTGESPFAG--DDKQETFLNV 244

  Fly   364 MSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAE 402
            ......|.::..|.:|..|...|..|||..|..|...|:
Zfish   245 SQVNVEYSRETFSRVSELAVDFIRKLLVKAPEDRPSAAD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 64/249 (26%)
PKc_like 164..403 CDD:304357 64/249 (26%)
stk17bNP_956829.1 STKc_DRAK2 24..290 CDD:271100 64/272 (24%)
S_TKc 32..290 CDD:214567 64/264 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.