DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and triob

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_009290354.2 Gene:triob / 368847 ZFINID:ZDB-GENE-030616-399 Length:3023 Species:Danio rerio


Alignment Length:307 Identity:84/307 - (27%)
Similarity:131/307 - (42%) Gaps:50/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 DSGTLESMKSHDLPEAI----------------------QLYIETIEPVEHNTRTLIYRG----- 166
            ||||...:.|:|:....                      .||.|.:|         :.||     
Zfish  2680 DSGTYTCIASNDVGSVTSSAYLRVLGTSCDGILWKDNFESLYTEVME---------LGRGRFAVT 2735

  Fly   167 ---QTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHL 228
               :.|.:|.....|:|||:...  |.....|..||:.|| ||:::.|:.|.|.......:||..
Zfish  2736 KWCEQRGSRRSVAAKLVNKKLMR--REQVVQELGVLQCLQ-HPHLVGLLDTYETPASYVLILEIA 2797

  Fly   229 D-CNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKV 292
            | ..:...|...|.|:|......:|..:.||.::|..::.|.|:||||:|:..:|.|   .:||:
Zfish  2798 DQGRILDYIVSWGNLTEEKVSLYLRDVLEALHYLHACRIAHLDLKPENVLIEQTSAK---PLVKL 2859

  Fly   293 ANF-DLATYYRGSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNS 356
            |:| |.|.......::...|:|.:.|||::.........|.|||||..:.||.|..||..  ::.
Zfish  2860 ADFGDAAHLSNTPYIHPLLGSPEFSAPELVLGEPAALASDLWSLGVLAYVMLSGASPFLD--ESV 2922

  Fly   357 KEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAEL 403
            :|....|.....::|:|....:|..|...|..||..:|..| |.|::
Zfish  2923 EETCLNICRIDFSFPEDYFHGVSQAARDFICMLLQGEPCRR-PSAQV 2968

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 74/250 (30%)
PKc_like 164..403 CDD:304357 74/248 (30%)
triobXP_009290354.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.