DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Speg

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_038939815.1 Gene:Speg / 363256 RGDID:2124 Length:3269 Species:Rattus norvegicus


Alignment Length:428 Identity:95/428 - (22%)
Similarity:166/428 - (38%) Gaps:87/428 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRRVGPPLHKKALRVCFLRNGDRH-FKGVNLVISRAHFKDFPALLQGVTES-------------- 59
            |||...||      .|..||  || .|..::.:..|....|.::::.|...              
  Rat  1470 SRRDLGPL------TCSARN--RHGTKACSITLELAEAPRFESIMEDVEVGPGETARFAVVVEGK 1526

  Fly    60 -------LKRHVLLRSAIAHFRRTDGSHLTSLSCFRETDIVICCCKNEE---IICVKYSINKDFQ 114
                   .|..|||         .:.:|::.:....|..:|:....:::   ..|...::..:. 
  Rat  1527 PLPDIMWYKDEVLL---------AESNHVSFVYEENECSLVVLSAGSQDGGVYTCTARNLAGEV- 1581

  Fly   115 RMVDSCKRWGQHHLDSGTLESMKSHDLPEAIQLYIETI-EPVEHNTRTL---------IYRGQ-- 167
                |||            ..:..|....|::  :|.: |..||..|.|         |.||.  
  Rat  1582 ----SCK------------AELSVHSAQTAME--VEGVGEDEEHRGRRLSDYYDIHQEIGRGAFS 1628

  Fly   168 ------TRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLE 226
                  .|::..:...|.:  .:|:..:.....||.:|.:|| |..::......|..|.:..|.|
  Rat  1629 YLRRVVERSSGLEFAAKFI--PSQAKPKASARREARLLARLQ-HDCVLYFHEAFERRRGLVIVTE 1690

  Fly   227 HLDCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVK 291
            .....:.:.:.::..:.|::.|:.||..:..:.::||..|:|.|:|||||||...:|  ..:.|:
  Rat  1691 LCTEELLERMARKPTVCESETRTYMRQVLEGIGYLHQSHVLHLDVKPENLLVWDGAG--GEEQVR 1753

  Fly   292 VANFDLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKN 355
            :.:|..|.... |...|.:.|||.::|||::..|......|.|.:||..|..|.|..||..  :|
  Rat  1754 ICDFGNAQELTPGEPQYCQFGTPEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVG--EN 1816

  Fly   356 SKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSD 393
            .:.....|.:....:.:.....:|.||...:..:||.|
  Rat  1817 DRTTLMNIRNYNVAFEETTFLSLSREARGFLIKVLVQD 1854

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 17/114 (15%)
S_TKc 164..409 CDD:214567 61/239 (26%)
PKc_like 164..403 CDD:304357 61/239 (26%)
SpegXP_038939815.1 I-set 45..127 CDD:400151
Ig strand A 45..47 CDD:409353
Ig strand A' 49..55 CDD:409353
Ig strand B 62..69 CDD:409353
Ig strand C 75..80 CDD:409353
Ig strand C' 82..85 CDD:409353
Ig strand F 106..114 CDD:409353
Ig strand G 117..127 CDD:409353
PHA03247 <324..681 CDD:223021
Ig strand A 736..739 CDD:409353
I-set 737..826 CDD:400151
Ig strand A' 742..746 CDD:409353
Ig strand B 754..762 CDD:409353
Ig strand C 767..772 CDD:409353
Ig strand C' 775..777 CDD:409353
Ig strand D 783..788 CDD:409353
Ig strand E 791..796 CDD:409353
Ig strand F 805..813 CDD:409353
Ig strand G 816..826 CDD:409353
SPEG_u2 827..883 CDD:293256
IgI_APEG-1_like 884..974 CDD:409567
Ig strand B 901..905 CDD:409567
Ig strand C 914..918 CDD:409567
Ig strand E 940..944 CDD:409567
Ig strand F 954..959 CDD:409567
Ig strand G 967..970 CDD:409567
Ig 988..1073 CDD:416386
Ig strand A' 991..994 CDD:409353
Ig strand B 998..1007 CDD:409353
Ig strand C 1012..1018 CDD:409353
Ig strand C' 1021..1023 CDD:409353
Ig strand D 1030..1035 CDD:409353
Ig strand E 1038..1045 CDD:409353
Ig strand F 1053..1060 CDD:409353
Ig strand G 1063..1073 CDD:409353
Ig 1079..1168 CDD:416386
Ig strand A 1079..1082 CDD:409353
Ig strand A' 1085..1090 CDD:409353
Ig strand B 1095..1102 CDD:409353
Ig strand C 1109..1115 CDD:409353
Ig strand C' 1116..1119 CDD:409353
Ig strand D 1124..1130 CDD:409353
Ig strand E 1133..1143 CDD:409353
Ig strand F 1147..1155 CDD:409353
Ig strand G 1157..1168 CDD:409353
I-set 1203..1292 CDD:400151
Ig strand A 1203..1206 CDD:409353
Ig strand A' 1209..1214 CDD:409353
Ig strand B 1219..1226 CDD:409353
Ig strand C 1233..1239 CDD:409353
Ig strand C' 1240..1243 CDD:409353
Ig strand D 1248..1254 CDD:409353
Ig strand E 1257..1267 CDD:409353
Ig strand F 1271..1279 CDD:409353
Ig strand G 1281..1292 CDD:409353
I-set 1500..1589 CDD:400151 13/114 (11%)
Ig strand A' 1508..1511 CDD:409353 1/2 (50%)
Ig strand B 1515..1524 CDD:409353 0/8 (0%)
Ig strand C 1529..1535 CDD:409353 0/5 (0%)
Ig strand C' 1538..1540 CDD:409353 1/1 (100%)
Ig strand D 1546..1551 CDD:409353 0/4 (0%)
Ig strand E 1554..1561 CDD:409353 2/6 (33%)
Ig strand F 1569..1576 CDD:409353 1/6 (17%)
Ig strand G 1579..1589 CDD:409353 3/26 (12%)
STKc_SPEG_rpt1 1613..1869 CDD:271010 62/249 (25%)
PHA03247 <1951..2352 CDD:223021
I-set 2594..2684 CDD:400151
Ig strand A 2594..2596 CDD:409353
Ig strand A' 2599..2604 CDD:409353
Ig strand B 2611..2619 CDD:409353
Ig strand C 2624..2628 CDD:409353
Ig strand D 2639..2646 CDD:409353
Ig strand E 2649..2654 CDD:409353
Ig strand F 2663..2671 CDD:409353
Ig strand G 2674..2684 CDD:409353
PHA03247 <2785..2910 CDD:223021
PKc_like 2964..3220 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.