DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and sqa

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster


Alignment Length:250 Identity:73/250 - (29%)
Similarity:122/250 - (48%) Gaps:11/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 IYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEH 227
            :|:.:.:||..:...|.| ...:..|:.:...|.|::..||.| .||:|....|.::.|..|||.
  Fly    48 VYKCRDKANGLQLAAKFV-PIPKREDKRNVEREVEIMNSLQHH-LIIQLYAAYEYQKMMCVVLEL 110

  Fly   228 LDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMV 290
            ::..  ..:|:....:|:|...|..:|....|:|.:|...::|.|:||||:||.:..|    ..:
  Fly   111 IEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKG----NRI 171

  Fly   291 KVANFDLATYYRGSK-LYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACK 354
            |:.:|.||..:...| |.|..|||.::|||::......|..|.||:||..:.::.|..||..  :
  Fly   172 KIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMG--E 234

  Fly   355 NSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFL 409
            |..|..:.:......:..:..:.:|||....|..||..|.|.|:..||..|.::|
  Fly   235 NDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 72/247 (29%)
PKc_like 164..403 CDD:304357 70/241 (29%)
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 72/248 (29%)
STKc_MLCK 40..289 CDD:271005 72/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.