DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Unc-89

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001097440.1 Gene:Unc-89 / 3346201 FlyBaseID:FBgn0053519 Length:4218 Species:Drosophila melanogaster


Alignment Length:400 Identity:82/400 - (20%)
Similarity:160/400 - (40%) Gaps:77/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RNGDRHFKGVNLVISRAH-FKDFPALLQ----------------GVTESLKRHVLLRSAIAHFRR 75
            :||....|.|.:.:...| |||:..::.                .:.:|:.:...|.|..|  |.
  Fly  3082 KNGRIEAKLVGIPLPEVHWFKDWKPIVDSSRIKISSYDPDIYVLSIHDSIIKDGGLYSISA--RN 3144

  Fly    76 TDGSHLTSLSCFRETDIVICCCKNEEIICVKYSINKDFQRMVDSCKRWGQH-HLDSGTLESMKSH 139
            ..||..||::...|        :||:    :|..           |.:|:| ::.|..|.....:
  Fly  3145 IAGSISTSVTVHIE--------ENED----QYIY-----------KTYGRHPYVRSKQLRYQDKY 3186

  Fly   140 DLPEAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQ- 203
            |:.:.:          ...|:.:.|....|::......|::        .|...:...:|.:|: 
  Fly  3187 DIGDEL----------GRGTQGITYHAVERSSGDNYAAKIM--------YGRPELRPFMLNELEM 3233

  Fly   204 ----SHPNIIELMYTVEDERYMYTVLEHLDCNMQKV---IQKRGILSEADARSVMRCTVSALAHM 261
                :|.|:|. .|...|.....|::..|....:.|   :.:|...:|.|....:|.|:..|.||
  Fly  3234 MNTFNHKNLIR-PYDAYDTDRSVTLIMELAAGGELVRDNLLRRDYYTERDIAHYIRQTLWGLEHM 3297

  Fly   262 HQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKL-YVRCGTPCYMAPEMIAMSG 325
            |::.|.|..:..::||:....|    .::||::|.|:.......| .:..|.|.:::||::...|
  Fly  3298 HEMGVGHMGLTIKDLLISVVGG----DIIKVSDFGLSRKINRHNLSTLDYGMPEFVSPEVVNKEG 3358

  Fly   326 YDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLL 390
            .::..|.|::|:..:.:|.|..||...  :.:|....|..|...:..::.:.:|.:....|..||
  Fly  3359 VNFSHDMWTVGLITYVLLGGHNPFLGI--DDRETLTKIREGRWDFKDEIWTHISDDGRDFISRLL 3421

  Fly   391 VSDPSYRVPI 400
            :..|..|:.:
  Fly  3422 LYSPEERMDV 3431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 20/96 (21%)
S_TKc 164..409 CDD:214567 54/245 (22%)
PKc_like 164..403 CDD:304357 54/245 (22%)
Unc-89NP_001097440.1 RhoGEF 90..260 CDD:238091
PH_unc89 275..388 CDD:270134
Atrophin-1 <493..690 CDD:331285
TonB_N 502..>596 CDD:318287
I-set 1017..1108 CDD:333254
I-set 1123..1212 CDD:254352
I-set <1236..1299 CDD:333254
I-set 1313..1403 CDD:254352
Ig_3 1406..1487 CDD:316449
I-set 1499..1595 CDD:254352
I-set 1599..1690 CDD:333254
I-set 1694..1786 CDD:254352
I-set <1836..1903 CDD:333254
I-set 1922..2005 CDD:333254
I-set 2018..2108 CDD:333254
I-set 2113..2214 CDD:333254
I-set 2220..2302 CDD:254352
I-set 2318..2408 CDD:254352
I-set 2415..2506 CDD:254352
I-set 2519..2608 CDD:254352
I-set 2615..2696 CDD:254352
I-set 2717..2805 CDD:254352
FN3 2834..2925 CDD:238020
I-set <2996..3063 CDD:333254
I-set 3067..3157 CDD:333254 17/76 (22%)
PK_Unc-89_rpt1 3182..3440 CDD:271011 56/274 (20%)
I-set 3654..3744 CDD:333254
FN3 3748..3840 CDD:238020
STKc_Unc-89_rpt2 3893..4151 CDD:271014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.