DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and PhKgamma

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_511129.3 Gene:PhKgamma / 32120 FlyBaseID:FBgn0011754 Length:560 Species:Drosophila melanogaster


Alignment Length:299 Identity:85/299 - (28%)
Similarity:137/299 - (45%) Gaps:49/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LP--EAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQ-----------TQSNDRGDT 192
            ||  :|.:.:....||.|     ::.||.:...| :|..|...|:           |:|.:....
  Fly    10 LPDKDAAKGFYAKYEPKE-----ILGRGISSTVR-RCIEKETGKEFAAKIIDLGATTESGETNPY 68

  Fly   193 YM------EAEVLRQLQSHPNIIELMYTVEDERYMYTVLE-----HLDCNMQKVIQKRGILSEAD 246
            :|      |..:|||:..||.||:|....|.:.:::.|.|     .|...:..|:    .|||..
  Fly    69 HMLEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVV----TLSEKK 129

  Fly   247 ARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYR-GSKLYVRC 310
            .|::||.....:.::|...::|||:||||:|:..:..      ||:.:|..|...: |.||...|
  Fly   130 TRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHN------VKITDFGFAKQLQEGEKLTNLC 188

  Fly   311 GTPCYMAPEMIAMS------GYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPT 369
            |||.|:|||.:..:      ||..:||.|:.||.:|.:|.|..||..  :....:...||.|..:
  Fly   189 GTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWH--RKQMVMLRNIMEGKYS 251

  Fly   370 YPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQF 408
            :.....:.:|.:...||...||.|||.|:.:.|:.:..|
  Fly   252 FTSPEWADISEDPKDLIRKCLVVDPSQRITVKEVLRHPF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 79/274 (29%)
PKc_like 164..403 CDD:304357 77/267 (29%)
PhKgammaNP_511129.3 STKc_PhKG 19..291 CDD:270995 82/290 (28%)
S_TKc 23..291 CDD:214567 82/286 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR44167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.