DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Pskh1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_775608.1 Gene:Pskh1 / 244631 MGIID:3528383 Length:424 Species:Mus musculus


Alignment Length:260 Identity:81/260 - (31%)
Similarity:130/260 - (50%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 EHNTRTLIYRG--------QTRANRTKCTVKMVNKQTQSNDRGDTYMEAE--VLRQLQSHPNIIE 210
            :::.:.||.||        :.||.|....:||:..:.:   .|....|:|  |||::: |.|||:
Mouse    97 KYDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYR---EGREVCESELRVLRRVR-HANIIQ 157

  Fly   211 LMYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKP 273
            |:...|.:..:|.|:|.....  ..::|.| |..:|.||..|::..:..:.::|.|.:.|||:||
Mouse   158 LVEVFETQERVYMVMELATGGELFDRIIAK-GSFTERDATRVLQMVLDGVRYLHALGITHRDLKP 221

  Fly   274 ENLLVC--SSSGKWNFKMVKVANFDLAT-YYRGSKLYVR--CGTPCYMAPEMIAMSGYDYQVDSW 333
            ||||..  .:..|     :.:.:|.||: ..:|....::  ||||.|:|||::....|...||.|
Mouse   222 ENLLYYHPGTDSK-----IIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMW 281

  Fly   334 SLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRV 398
            :|||..:.:|.|.|||..  .|...:|..|:.|..:|..:....:|..|...||.||..||..|:
Mouse   282 ALGVIAYILLSGTMPFED--DNRTRLYRQILRGKYSYLGEPWPSVSNLAKDFIDRLLTVDPGARM 344

  Fly   399  398
            Mouse   345  344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 79/252 (31%)
PKc_like 164..403 CDD:304357 79/252 (31%)
Pskh1NP_775608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..79
STKc_PSKH1 96..355 CDD:270989 81/260 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.