DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Mylk2

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001074513.2 Gene:Mylk2 / 228785 MGIID:2139434 Length:613 Species:Mus musculus


Alignment Length:233 Identity:68/233 - (29%)
Similarity:119/233 - (51%) Gaps:11/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 RANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDCN-- 231
            ||...|...|::.||| ..|:....:|.||:.|| :|.|:|:|...:|....:...:|:::..  
Mouse   322 RATGLKLAAKVIKKQT-PKDKEMVLLEIEVMNQL-NHRNLIQLYAAIETSHEIILFMEYIEGGEL 384

  Fly   232 MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFD 296
            .::::.:...|:|.|....:|.....:..||:::|:|.|:||||:|..:::|    .:||:.:|.
Mouse   385 FERIVDEDYHLTEVDTMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTG----HLVKIIDFG 445

  Fly   297 LATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIY 360
            ||..|. ..||.|..|||.:::||::.......:.|.|||||..:.:|.|..||..  .:..|..
Mouse   446 LARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSLGVITYMLLSGLSPFLG--DDDTETL 508

  Fly   361 AAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRV 398
            ..::|....:.::....:|.||...:..||..|.|.|:
Mouse   509 NNVLSANWYFDEETFEAVSDEAKDFVSNLLTKDQSARM 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 68/233 (29%)
PKc_like 164..403 CDD:304357 68/233 (29%)
Mylk2NP_001074513.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..240
STKc_MLCK2 298..557 CDD:271092 68/233 (29%)
S_TKc 308..557 CDD:214567 68/233 (29%)
Calmodulin-binding. /evidence=ECO:0000250 591..603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.