DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Mylk3

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_780650.2 Gene:Mylk3 / 213435 MGIID:2443063 Length:795 Species:Mus musculus


Alignment Length:332 Identity:85/332 - (25%)
Similarity:140/332 - (42%) Gaps:53/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 QHHLDSGTL--ESMKSH-----------DLPEAIQLYIETIE-------PVEHNT----RTLIYR 165
            |..:|.|.:  |..|.|           .|..|.:..|..::       |.||..    .|||..
Mouse   423 QQGIDPGAVSPEPGKDHAAQGPGRTEAGRLSSAAEAAIVVLDDSAAPPAPFEHRVVSIKDTLISA 487

  Fly   166 GQTRANRT-----------KCTVK--------MVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIEL 211
            |.|.:...           :||.:        .:.|.....||.|...|..::.|| ||.|:|:|
Mouse   488 GYTVSQHEVLGGGRFGQVHRCTERSTGLALAAKIIKVKNVKDREDVKNEVNIMNQL-SHVNLIQL 551

  Fly   212 MYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPE 274
            ....|.:.....::|::|..  ..::..::..|:|.|.....|.....:.::||..::|.|:|||
Mouse   552 YDAFESKSSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPE 616

  Fly   275 NLLVCSSSGKWNFKMVKVANFDLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVT 338
            |:|..|.:|    ..:|:.:|.||..|: ..||.|..|||.::|||::......:..|.||:||.
Mouse   617 NILCVSQTG----HQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVI 677

  Fly   339 LFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAEL 403
            .:.:|.|..||..  :...|....|::....:..|....:|.||...:..|||.:.|.|:...:.
Mouse   678 TYMLLSGLSPFLG--ETDAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVKEKSCRMSATQC 740

  Fly   404 DKFQFLA 410
            .|.::|:
Mouse   741 LKHEWLS 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 69/266 (26%)
PKc_like 164..403 CDD:304357 68/260 (26%)
Mylk3NP_780650.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..258
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..452 6/28 (21%)
STKc_MLCK3 486..746 CDD:271094 69/266 (26%)
S_TKc 494..746 CDD:214567 67/258 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.