DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and F32D8.1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_505770.3 Gene:F32D8.1 / 185203 WormBaseID:WBGene00009326 Length:333 Species:Caenorhabditis elegans


Alignment Length:304 Identity:88/304 - (28%)
Similarity:142/304 - (46%) Gaps:45/304 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RMVDSCKRWGQHHLDSGTLESMKSHDLPEAIQLYIETIE-----PVEHNTRTLIYRG-------- 166
            |||.:..|    |::.|..          .:..:|:.::     ..::....:|.:|        
 Worm    38 RMVHTSSR----HVNEGFF----------GVSKWIQRVDGRQDIEKQYEIGAIIGKGNFSSVHLT 88

  Fly   167 QTRANRTKCTVKMVNKQTQSNDRGDTYM---EAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHL 228
            :.:.:.|||.:|.|.|:..   ||..:.   |.|:|..:| |.:||.::.....|...:.|.||.
 Worm    89 RRKEDGTKCALKQVEKRAM---RGKCFFVDNEVEMLSLIQ-HDHIISIIDAFSTENQYFIVFEHA 149

  Fly   229 DC-NMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKV 292
            .. ::.:.|:|.|.:.|.||..:.....|||.::|:..|:|||:||||||:.....      ||:
 Worm   150 QYGDLYETIRKNGRIEEPDAAIITLQVASALNYLHERNVVHRDVKPENLLLVDKFS------VKL 208

  Fly   293 ANFDLATYYRGSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSK 357
            .:|.||.:..| .||..||||.|.|||::..:||..:.|.|||||.|:.||.|..||.:  .:..
 Worm   209 CDFGLACHILG-PLYRICGTPTYCAPEVLRETGYSTRCDIWSLGVVLYVMLVGYAPFRA--PDQT 270

  Fly   358 EIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIA 401
            .::..||...|.........:|.:|..|:..|: :....|.|:|
 Worm   271 RLFKLIMQAKPNLDMPEWKGISLKAKDLVSRLM-NKTEERRPLA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 80/250 (32%)
PKc_like 164..403 CDD:304357 80/250 (32%)
F32D8.1NP_505770.3 STKc_CAMK 70..321 CDD:270687 81/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.