DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and kin-33

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001367716.1 Gene:kin-33 / 178549 WormBaseID:WBGene00017083 Length:337 Species:Caenorhabditis elegans


Alignment Length:215 Identity:65/215 - (30%)
Similarity:106/215 - (49%) Gaps:21/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 HPNIIELMYTVEDERYMYTVLEHLD-CNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIH 268
            |.|:|..:.......:.:.::|:.| .::...|.....|:.:.|....:..::.|.::|...|.|
 Worm    79 HENVIRFLSIRTMPEHYFLIMEYADGGDLFDKISSEYRLTSSQAHGYFKQLIAGLRYIHSKGVTH 143

  Fly   269 RDIKPENLLVCSSSGKWNFKMVKVANFDLATYY--RG--SKLYVRCGTPCYMAPEMIAMSGYDYQ 329
            ||||||||::..:.      ::|:.:|.|.|.:  :|  |.:..|||||.|.|||::.  |..|:
 Worm   144 RDIKPENLMLTKAG------VLKITDFGLGTLHIIKGEESLMDTRCGTPQYAAPEVLV--GNQYR 200

  Fly   330 ---VDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLV 391
               ||.||.||.|..||.|..|:..||| |...|....:...| .:|..|.:......|:..:|.
 Worm   201 GPPVDIWSAGVVLINMLTGHSPWKKACK-SDASYTRWFNDECT-ERDAWSDLGARVITLLCSILA 263

  Fly   392 SDPSYRVPIAELDK---FQF 408
            .:|::|.||..:::   |||
 Worm   264 HNPTHRAPIELIEQDHWFQF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 65/215 (30%)
PKc_like 164..403 CDD:304357 62/205 (30%)
kin-33NP_001367716.1 PKc_like 16..281 CDD:419665 62/211 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.