DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and cmk-1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_500139.1 Gene:cmk-1 / 176989 WormBaseID:WBGene00000553 Length:348 Species:Caenorhabditis elegans


Alignment Length:327 Identity:85/327 - (25%)
Similarity:140/327 - (42%) Gaps:66/327 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FRRTDGSHLTSLSCFRETDIVICCCKNEEIICVKYSINKDFQRMVDSCKRWGQHHLDSGTLESMK 137
            |:|.|||.....:..||                ||    ||:.::      |........|...|
 Worm     4 FKRRDGSGPAPNATIRE----------------KY----DFRDVL------GTGAFSKVFLAESK 42

  Fly   138 SHDLPEAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQL 202
            |    :|.|:|                           .||.::|:...........|.:|||:|
 Worm    43 S----DAGQMY---------------------------AVKCIDKKALKGKEESLENEIKVLRKL 76

  Fly   203 QSHPNIIELMYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQ 265
            : |.||::|..|.::::::|.|:|.:...  ..:::.| |..:|.||.:::|..:.|:..||...
 Worm    77 R-HNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAK-GSYTEQDASNLIRQVLEAVGFMHDNG 139

  Fly   266 VIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLYVRCGTPCYMAPEMIAMSGYDYQV 330
            |:|||:||||||..:..   ....:.:::|.|:.......:...||||.|:|||::....|...|
 Worm   140 VVHRDLKPENLLYYNQD---EDSKIMISDFGLSKTEDSGVMATACGTPGYVAPEVLQQKPYGKAV 201

  Fly   331 DSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPS 395
            |.||:||..:.:|||..||..  ::...::|.|:.|...:.......:|..|...|..|:..||.
 Worm   202 DVWSIGVIAYILLCGYPPFYD--ESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPE 264

  Fly   396 YR 397
            .|
 Worm   265 AR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 8/34 (24%)
S_TKc 164..409 CDD:214567 67/236 (28%)
PKc_like 164..403 CDD:304357 67/236 (28%)
cmk-1NP_500139.1 STKc_CaMKI 18..277 CDD:270985 80/313 (26%)
S_TKc 22..278 CDD:214567 77/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.