DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and R06A10.4

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001380035.1 Gene:R06A10.4 / 171688 WormBaseID:WBGene00019911 Length:391 Species:Caenorhabditis elegans


Alignment Length:265 Identity:77/265 - (29%)
Similarity:131/265 - (49%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYT 214
            |.:..|...:.:.:.|.|.|..|....||:||     .|.|....|..:|.:| |||.:|.|...
 Worm    72 EVLAVVGKGSFSQVLRVQHRVTRKYFAVKVVN-----GDCGAVNNELNILSRL-SHPFVIRLEEV 130

  Fly   215 VEDERYMYTVLEHLD-CNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLV 278
            .:....::.|::... ..|...:..:|..||.:||:.::..::.|.::|.::|.|||:||||||.
 Worm   131 FKSSSKLFIVMQMASGGEMYDRVVAKGRYSEEEARNALKMLLTGLTYLHSIRVTHRDLKPENLLY 195

  Fly   279 CSSSGKWNFKMVKVANFDLATYYRGSK----LYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTL 339
            ..|..:   ..:.:.:|.||  |:.:|    :...||||.|:|||::....|..:||.|::||..
 Worm   196 ADSRPE---ARLLITDFGLA--YQATKPNETMTETCGTPEYIAPELLLRVPYTQKVDMWAVGVIA 255

  Fly   340 FYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELD 404
            :.::.|.|||...|::  .:|..|::....|.....| .|..|.|.:|.||.::...|:..:...
 Worm   256 YILMSGIMPFDDDCRS--RLYTHIITANYVYYPQFWS-GSELAKQFVDSLLETNSVERLSSSAAM 317

  Fly   405 KFQFL 409
            |.::|
 Worm   318 KHEWL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 74/249 (30%)
PKc_like 164..403 CDD:304357 73/243 (30%)
R06A10.4NP_001380035.1 STKc_PSKH1 69..322 CDD:270989 76/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.