DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Camk1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_006237061.1 Gene:Camk1 / 171503 RGDID:629473 Length:414 Species:Rattus norvegicus


Alignment Length:253 Identity:70/253 - (27%)
Similarity:120/253 - (47%) Gaps:22/253 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELM 212
            :.|.|...:..|:.|:            .:|.:.|:......|....|..||.::: ||||:.|.
  Rat    62 FSEVILAEDKRTQKLV------------AIKCIAKKALEGKEGSMENEIAVLHKIK-HPNIVALD 113

  Fly   213 YTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPEN 275
            ...|...::|.:::.:...  ..::::| |..:|.||..::...:.|:.::|.|.::|||:||||
  Rat   114 DIYESGGHLYLIMQLVSGGELFDRIVEK-GFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPEN 177

  Fly   276 LLVCSSSGKWNFKMVKVANFDLATYY-RGSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTL 339
            ||..|..   ....:.:::|.|:... .||.|...||||.|:|||::|...|...||.||:||..
  Rat   178 LLYYSLD---EDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIA 239

  Fly   340 FYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYR 397
            :.:|||..||..  :|..:::..|:.....:.......:|..|...|..|:..||..|
  Rat   240 YILLCGYPPFYD--ENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 66/237 (28%)
PKc_like 164..403 CDD:304357 66/237 (28%)
Camk1XP_006237061.1 STKc_CaMKI_alpha 47..309 CDD:271069 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.