DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Stk17b

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_596883.1 Gene:Stk17b / 170904 RGDID:620457 Length:371 Species:Rattus norvegicus


Alignment Length:273 Identity:69/273 - (25%)
Similarity:125/273 - (45%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 TIEPVEHNTRTLIYRGQ--------TRANRTKCTVKMVNKQTQSND-RGDTYMEAEVLRQLQSHP 206
            |:.|.|      :.||:        :::...:...|.:.|:.:..| |.:...|..||...:|.|
  Rat    33 TLTPKE------LGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELARSCP 91

  Fly   207 NIIELMYTVEDERYMYTVLEH------LDCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQ 265
            ::|.|....|....:..|||:      .:..:.::.:   ::||.|...:::..:..:.::||..
  Rat    92 HVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAE---MVSENDVIRLIKQILEGVHYLHQNN 153

  Fly   266 VIHRDIKPENLLVCSSSGKWNFKMV------KVANFDLATYYRGSKLYVRCGTPCYMAPEMIAMS 324
            ::|.|:||:|:|:.|.....:.|:|      |:.|        .|:|....|||.|:|||::...
  Rat   154 IVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGN--------ASELREIMGTPEYLAPEILNYD 210

  Fly   325 GYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGL 389
            ......|.|::|:..:.:|....||..  ::::|.|..|......|.::|.|.:|..||..|..|
  Rat   211 PITTATDMWNIGIIAYMLLTHTSPFVG--EDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSL 273

  Fly   390 LVSDPSYRVPIAE 402
            ||.:|..| |.||
  Rat   274 LVKNPEKR-PTAE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 66/260 (25%)
PKc_like 164..403 CDD:304357 66/260 (25%)
Stk17bNP_596883.1 STKc_DRAK2 24..293 CDD:271100 69/273 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.