DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and EFHB

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_653316.3 Gene:EFHB / 151651 HGNCID:26330 Length:833 Species:Homo sapiens


Alignment Length:332 Identity:56/332 - (16%)
Similarity:112/332 - (33%) Gaps:105/332 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 HDLPEAIQLYIET------------IEPVEHNTRTLIY--------RGQTRANRTKCTV----KM 179
            |.|...:....||            :.|.|:....||:        ||:.|.......|    |.
Human   493 HKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKK 557

  Fly   180 VNKQ---------TQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDCNMQKV 235
            ||.|         ...:.:||..::.:.|::.....|:      ..|::.:..:.::.|.:....
Human   558 VNYQKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANL------SLDDKLLDQLFDYCDVDNDGF 616

  Fly   236 I-----------QKRGILSEADARSVMR-----CTVSALAHMHQLQVIHRDIKPENLLV--CSSS 282
            |           :.:.:|.|.:.|.:::     |.....|::.:.:.... ||||::::  ..|:
Human   617 INYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANVEEPEQTLL-IKPEDIVLKEAGST 680

  Fly   283 GKWNFKMVKVANFDLATYYR-------------GSKLYVRCGTPCYM----APEMIAMS---GYD 327
            .|....:::.:: .::.||:             .|..|..||.|...    ||.:..:|   .|.
Human   681 EKTLRTLLRPSD-KVSNYYKTTSSEINAIVGAIPSTCYPICGVPTIRSDIPAPRIRRISDRTNYG 744

  Fly   328 YQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLI---DGL 389
            .:..::||                       :|..|.:....:.:|.....|.|....|   .|:
Human   745 EEGSAYSL-----------------------LYPTIFARKGVFERDFFKTRSKEEIAEILCNIGV 786

  Fly   390 LVSDPSY 396
            .:||..:
Human   787 KLSDEEF 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 48/295 (16%)
PKc_like 164..403 CDD:304357 48/295 (16%)
EFHBNP_653316.3 EF-hand_7 566..626 CDD:290234 7/65 (11%)
EFh 566..626 CDD:238008 7/65 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.