DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and PNCK

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001034671.3 Gene:PNCK / 139728 HGNCID:13415 Length:426 Species:Homo sapiens


Alignment Length:280 Identity:80/280 - (28%)
Similarity:132/280 - (47%) Gaps:14/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 GQH--HLDSGTLESM---KSHDLPEAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQ 183
            |:|  .:.:..|:.|   |.|  .|.|....|..|.:.....:.:...|.|.:.....:|.:.|:
Human    70 GRHPSRIPAIALQDMLLLKKH--TEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKK 132

  Fly   184 TQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHL-DCNMQKVIQKRGILSEADA 247
            ...........|..|||:: |||||:.|....|...::|..:|.: ...:...|.:||..:|.||
Human   133 ALRGKEALVENEIAVLRRI-SHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDA 196

  Fly   248 RSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLYVRCGT 312
            ..::...:.|::::|.|.::|||:||||||..:   .:....:.|::|.|:....|:.|...|||
Human   197 SHLVGQVLGAVSYLHSLGIVHRDLKPENLLYAT---PFEDSKIMVSDFGLSKIQAGNMLGTACGT 258

  Fly   313 PCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESV 377
            |.|:|||::....|...||.|:|||..:.:|||..||..  ::..|:::.|:.....:.......
Human   259 PGYVAPELLEQKPYGKAVDVWALGVISYILLCGYPPFYD--ESDPELFSQILRASYEFDSPFWDD 321

  Fly   378 MSPEATQLIDGLLVSDPSYR 397
            :|..|...|..||..||..|
Human   322 ISESAKDFIRHLLERDPQKR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 70/235 (30%)
PKc_like 164..403 CDD:304357 70/235 (30%)
PNCKNP_001034671.3 STKc_CaMKI_beta 94..370 CDD:271071 73/254 (29%)
S_TKc 98..353 CDD:214567 72/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.