DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and CAPSL

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_006714507.1 Gene:CAPSL / 133690 HGNCID:28375 Length:225 Species:Homo sapiens


Alignment Length:209 Identity:36/209 - (17%)
Similarity:69/209 - (33%) Gaps:72/209 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 HDLPEAIQL---YIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNK--QTQSNDRGDTYMEAEV 198
            ||...|||.   .....:|:|......:.||       ...:|.:.:  :...:|...|....|.
Human    24 HDREMAIQAKKKLTTATDPIERLRLQCLARG-------SAGIKGLGRVFRIMDDDNNRTLDFKEF 81

  Fly   199 LRQLQSHPNI-----IELMY---------TVEDERYMYTVLEHLDCNMQKVIQKR---------G 240
            ::.|..:..:     :|.::         |::...::.|:...:....::||.:.         |
Human    82 MKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDG 146

  Fly   241 ILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMV---KVANFD------ 296
            :::..|.|.|...     .|..:.|                :|:|:.:.|   .:.|||      
Human   147 VITIEDLREVYNA-----KHHPKYQ----------------NGEWSEEQVFRKFLDNFDSPYDKD 190

  Fly   297 -LAT------YYRG 303
             |.|      ||.|
Human   191 GLVTPEEFMNYYAG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 29/181 (16%)
PKc_like 164..403 CDD:304357 29/181 (16%)
CAPSLXP_006714507.1 EF-hand_7 61..118 CDD:290234 6/56 (11%)
EFh 63..118 CDD:238008 6/54 (11%)
EF-hand_7 100..157 CDD:290234 7/56 (13%)
EFh 101..155 CDD:238008 6/53 (11%)
EF-hand_7 133..202 CDD:290234 15/89 (17%)
EFh 133..199 CDD:298682 15/86 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.