DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Dcx

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001103692.1 Gene:Dcx / 13193 MGIID:1277171 Length:366 Species:Mus musculus


Alignment Length:286 Identity:67/286 - (23%)
Similarity:112/286 - (39%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GSRRVG--PPLH------------------KKALRVCFLRNGDRHFKGVNLVISRAHFKDFPALL 53
            |||..|  .|.|                  |||.:|.|.|||||:|||:...:|...|:.|.|||
Mouse    20 GSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALL 84

  Fly    54 QGVTESLKRHVLLRSAIAHFRRTDGSH-LTSLSCFRETDIVICCCKNEEIICVKYSINKDFQRMV 117
            ..:|.||..::.|...:.:....|||. :.|:....|.:..:|...|             |.:.|
Mouse    85 ADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDN-------------FFKKV 136

  Fly   118 DSCK----RWGQHHLDSGTLESMKSHDLPEAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVK 178
            :..|    .|..:...|..:::.:|.....:.|.. |..:.|.....|:|..|   ....|....
Mouse   137 EYTKNVNPNWSVNVKTSANMKAPQSLASSNSAQAR-ENKDFVRPKLVTIIRSG---VKPRKAVRV 197

  Fly   179 MVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLE--------HLDCNMQK- 234
            ::||:|..:..   .:..::...::....:::.:||::.::  .|.|.        .:.|..:| 
Mouse   198 LLNKKTAHSFE---QVLTDITEAIKLETGVVKKLYTLDGKQ--VTCLHDFFGDDDVFIACGPEKF 257

  Fly   235 -VIQKRGILSEADARSVMRCTVSALA 259
             ..|....|.|.:.| ||:...||.|
Mouse   258 RYAQDDFSLDENECR-VMKGNPSAAA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 31/108 (29%)
S_TKc 164..409 CDD:214567 20/106 (19%)
PKc_like 164..403 CDD:304357 20/106 (19%)
DcxNP_001103692.1 DCX1_DCX 51..139 CDD:340529 31/100 (31%)
DCX2 176..259 CDD:340589 14/90 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..366 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.946395 Normalized mean entropy S5828
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.820

Return to query results.
Submit another query.