DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Obsc

DIOPT Version :10

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_061508151.1 Gene:Obsc / 1276165 VectorBaseID:AGAMI1_006292 Length:5440 Species:Anopheles gambiae


Alignment Length:59 Identity:13/59 - (22%)
Similarity:23/59 - (38%) Gaps:8/59 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NKYLNSNGKLENKCTDDCLFSAEYHS--------GHLALRDRHGLYLSPIGSKAVLKSR 257
            |.:.|:......|||.:..|.....|        ..:.:||....::|...:|.|::.|
Mosquito    80 NNFTNTWETSTRKCTSETNFVTPSDSLKNDKDAVRFVFVRDPFRRFVSMYLNKCVVEKR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 13/59 (22%)
ObscXP_061508151.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.