DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Camk4

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_006525606.1 Gene:Camk4 / 12326 MGIID:88258 Length:497 Species:Mus musculus


Alignment Length:265 Identity:76/265 - (28%)
Similarity:129/265 - (48%) Gaps:17/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELM 212
            :.|....:.....:::||.:.:..:....:|::.|..   |:.....|..||.:| ||||||:|.
Mouse    69 FFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTV---DKKIVRTEIGVLLRL-SHPNIIKLK 129

  Fly   213 YTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPEN 275
            ...|....:..|||.:...  ..::::| |..||.||...::..:.|:|::|:..::|||:||||
Mouse   130 EIFETPTEISLVLELVTGGELFDRIVEK-GYYSERDAADAVKQILEAVAYLHENGIVHRDLKPEN 193

  Fly   276 LLVCSSSGKWNFKMVKVANFDLATYYRGSKLY-VRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTL 339
            ||..:.:..   ..:|:|:|.|:.......|. ..||||.|.|||::....|..:||.||:|:..
Mouse   194 LLYATPAPD---APLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIIT 255

  Fly   340 FYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELD 404
            :.:|||..||... :..:.::..|::....:.......:|..|..|:..|:|.||..|     |.
Mouse   256 YILLCGFEPFYDE-RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKR-----LT 314

  Fly   405 KFQFL 409
            .||.|
Mouse   315 TFQAL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 74/247 (30%)
PKc_like 164..403 CDD:304357 71/241 (29%)
Camk4XP_006525606.1 STKc_CaMKIV 66..359 CDD:270987 76/265 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.