DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Stk33

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_473444.1 Gene:Stk33 / 117229 MGIID:2152419 Length:491 Species:Mus musculus


Alignment Length:258 Identity:84/258 - (32%)
Similarity:138/258 - (53%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEV-LRQLQSHPNIIELMYTVEDERYMYTVL 225
            :::....:....|..:|.|||: ::.......:|.|| :.:..:|.:||.|....|..:.||.|:
Mouse   124 MVFEAIDKETGAKWAIKKVNKE-KAGSSAMKLLEREVSILKTVNHQHIIHLEQVFESPQKMYLVM 187

  Fly   226 EHL-DCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKM 289
            |.. |..::.|:.:||..||.:.|.:::...||:|::|...::|||:|.||::|.||....|.:|
Mouse   188 ELCEDGELKAVMDQRGHFSENETRLIIQSLASAIAYLHNKDIVHRDLKLENIMVKSSFIDDNNEM 252

  Fly   290 ---VKVANFDLATYYRGSK----LYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKM 347
               :||.:|.|:....||:    :...||||.|||||:|....|..|.|.||:||.:|.:|||:.
Mouse   253 NLNIKVTDFGLSVQKHGSRSEGMMQTTCGTPIYMAPEVINAHDYSQQCDIWSIGVIMFILLCGEP 317

  Fly   348 PFASACKNSKE-IYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFL 409
            ||.:   ||:| :|..|..|...:...:...:|..|...:..|:..||::|:...||...|:|
Mouse   318 PFLA---NSEEKLYELIKKGELRFENPVWESVSDSAKNTLKQLMKVDPAHRITAKELLDNQWL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 83/254 (33%)
PKc_like 164..403 CDD:304357 80/248 (32%)
Stk33NP_473444.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..89
PKc_like 109..377 CDD:419665 83/256 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44167
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.