DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and Chek2

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_446129.1 Gene:Chek2 / 114212 RGDID:621543 Length:545 Species:Rattus norvegicus


Alignment Length:329 Identity:93/329 - (28%)
Similarity:153/329 - (46%) Gaps:52/329 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 TDIVICCCKNEEIICVKYSINKDFQRMVDSCKRWGQHHLDSGTLESMKSHDLPEAIQLYIETIEP 154
            ::|.:..|:|:  :.|.:.:..|.|.:..  |.....::.|.||.|....::..|.:        
  Rat   190 SEIALSLCRNK--VFVFFDLTVDDQSVYP--KELRDEYIMSKTLGSGACGEVKMAFE-------- 242

  Fly   155 VEHNTRTLIYRGQTRANRTKCTVKMVNKQ---TQSNDRGDT----YMEAEVLRQLQSHPNIIEL- 211
                          |....|..:|:::|:   ..|:...||    ..|.|:|::| :||.||:: 
  Rat   243 --------------RKTCKKVAIKIISKRRFALGSSREADTAPSVETEIEILKKL-NHPCIIKIK 292

  Fly   212 -MYTVEDERYMYTVLEHLDCN--MQKVI-QKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIK 272
             ::.|||   .|.|||.::..  ..:|: .||  |.||..:......:.|:.::|:..:||||:|
  Rat   293 DVFDVED---YYIVLELMEGGELFDRVVGNKR--LKEATCKLYFYQMLLAVQYLHENGIIHRDLK 352

  Fly   273 PENLLVCSSSGKWNFKMVKVANFDLATYY-RGSKLYVRCGTPCYMAPEMI---AMSGYDYQVDSW 333
            |||:|:.|.....   ::|:.:|..:... ..|.:...||||.|:|||::   ..:||...||.|
  Rat   353 PENVLLSSQEEDC---LIKITDFGQSKILGETSLMRTLCGTPTYLAPEVLISNGTAGYSRAVDCW 414

  Fly   334 SLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRV 398
            ||||.||..|.|..|| |..|....:...|.||......::.:.:|.:|..|:..|||.||..|:
  Rat   415 SLGVILFICLSGYPPF-SEHKTQVSLKDQITSGKYNLIPEVWTDVSEKALDLVKKLLVVDPKARL 478

  Fly   399 PIAE 402
            ...|
  Rat   479 TTEE 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711 4/17 (24%)
S_TKc 164..409 CDD:214567 81/255 (32%)
PKc_like 164..403 CDD:304357 81/255 (32%)
Chek2NP_446129.1 FHA 96..204 CDD:238017 3/15 (20%)
STKc_Chk2 216..489 CDD:270986 87/301 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44167
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.