DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and camk1da

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001116532.1 Gene:camk1da / 100144566 ZFINID:ZDB-GENE-080402-7 Length:433 Species:Danio rerio


Alignment Length:234 Identity:65/234 - (27%)
Similarity:117/234 - (50%) Gaps:10/234 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 QTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDCN 231
            :.|:......||.:.|:...........|..|||::: |.||:.|....|...::|.:::.:...
Zfish    43 EERSTGKMYAVKCIPKKALKGKESSIENEIAVLRKIK-HENIVALEDIYESSDHLYLIMQLVSGG 106

  Fly   232 --MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVAN 294
              ..::::| |..:|.||.:::|..:.|:.::|.:.::|||:||||||..:..   :...:.:::
Zfish   107 ELFDRIVEK-GFYTEKDASTLIRQVLDAVNYLHTMGIVHRDLKPENLLYFNPQ---DGSKIMISD 167

  Fly   295 FDLATYY-RGSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSKE 358
            |.|:... .|..:...||||.|:|||::|...|...||.||:||..:.:|||..||..  :|..:
Zfish   168 FGLSKMEGTGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYD--ENDSK 230

  Fly   359 IYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYR 397
            ::..|:.....:.......:|..|...|..|:..|||.|
Zfish   231 LFEQILKADYEFDAPYWDDISDSAKDFISCLMEKDPSKR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 65/234 (28%)
PKc_like 164..403 CDD:304357 65/234 (28%)
camk1daNP_001116532.1 STKc_CaMKI_delta 14..314 CDD:271070 65/234 (28%)
S_TKc 25..281 CDD:214567 65/234 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.