DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk2 and kcnj11

DIOPT Version :9

Sequence 1:NP_001287485.1 Gene:Irk2 / 42770 FlyBaseID:FBgn0039081 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001034916.1 Gene:kcnj11 / 664687 ZFINID:ZDB-GENE-060308-2 Length:381 Species:Danio rerio


Alignment Length:362 Identity:158/362 - (43%)
Similarity:232/362 - (64%) Gaps:18/362 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RRRAVFKNGDCNVVQKHLQRRRVRFLQDMYTTMVDWQWRWTLLAFALSFILSWLFFALIWWLIIY 160
            :.|.|.|||.|||...:: |.:.|||||::||:||.:|..||:.|.:||:.|||.|.:|||||.:
Zfish    32 KARFVAKNGTCNVAHTNI-REQGRFLQDVFTTLVDLKWLHTLVIFTMSFLCSWLLFGMIWWLIAF 95

  Fly   161 THGDLEEPHLPENQEESGWAPCVSAIDGFTSCFLFSIETQHTIGYGVRTTSPECPEAIFMMCFQS 225
            .||||:       .:...:.|||:.|..|:|.||||||.|.|||:|.|..:.||..||.::..|:
Zfish    96 AHGDLD-------LKGEDFVPCVTDIHSFSSAFLFSIEVQVTIGFGGRMITEECVSAIVILILQN 153

  Fly   226 IYGVMSSAFMAGIVFAKMTRAKQRAQTLLFSKHAVICQRDGTLSLMFRVGDMRKSHIIGAGVRAQ 290
            |.|::.:|.|.|.:|.|..:|.:||:||:|||||||..|:..|..|||:||:|||.||.|.|..|
Zfish   154 IVGLVINAIMLGCIFMKTAQANRRAETLIFSKHAVITVRNNKLCFMFRLGDLRKSMIISATVHMQ 218

  Fly   291 LIRTKSTKEGEVMTQYFTELEIGTDDSGSDLFFIWPMVIEHKIDENSPLYNLNATDMLQDKFEIV 355
            ::|...|.|||::.....::::......:.:|.:.|::|.|.||:|||||:|:|.|:|.:..|::
Zfish   219 VVRKTVTSEGEMVPLDQIDIQMDNPVGTNSIFLVSPLIISHTIDKNSPLYDLSADDLLHEDIEVI 283

  Fly   356 VILEGTVESTGQSTQARSSYINTEILWGHRFDPVVLYNKDLQAYEIDYARFNETTQVDTPLCSAR 420
            |:|||.||:||.:||||:||::.||||||||.|.|  :::...|.:||::|..|.:|.||..|||
Zfish   284 VVLEGVVETTGITTQARTSYLSEEILWGHRFVPTV--SEEDGMYAVDYSKFGNTVKVATPNSSAR 346

  Fly   421 ELNEI-----YKIQEGFRTPAETTFTMRQLSHNHSDQ 452
            .|.|.     :|:||   |........|::.|.::.:
Zfish   347 TLEEAGGMERFKLQE---TSGACAAVRRRVKHPNTKE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk2NP_001287485.1 IRK 100..434 CDD:279361 154/338 (46%)
kcnj11NP_001034916.1 IRK 36..362 CDD:279361 154/338 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3827
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59160
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.