DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk2 and KCNJ8

DIOPT Version :9

Sequence 1:NP_001287485.1 Gene:Irk2 / 42770 FlyBaseID:FBgn0039081 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_004973.1 Gene:KCNJ8 / 3764 HGNCID:6269 Length:424 Species:Homo sapiens


Alignment Length:398 Identity:167/398 - (41%)
Similarity:248/398 - (62%) Gaps:28/398 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TIVPNRPTSYYGLSQNGKPFPRQPSCRSRNFRPGSMRRVRRRAVFKNGDCNVVQKHLQRRRVRFL 121
            :|:|..    |.|::......|:|..|.        |..:.|.:.|:|.||:..|:: |.:.|||
Human     6 SIIPEE----YVLARIAAENLRKPRIRD--------RLPKARFIAKSGACNLAHKNI-REQGRFL 57

  Fly   122 QDMYTTMVDWQWRWTLLAFALSFILSWLFFALIWWLIIYTHGDLEEPHLPENQEESGW--APCVS 184
            ||::||:||.:||.||:.|.:||:.|||.||::|||:.:.|||:.........|:||.  ..||:
Human    58 QDIFTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVCVT 122

  Fly   185 AIDGFTSCFLFSIETQHTIGYGVRTTSPECPEAIFMMCFQSIYGVMSSAFMAGIVFAKMTRAKQR 249
            .:..|||.||||||.|.|||:|.|..:.|||.||.::..|:|.|::.:|.|.|.:|.|..:|.:|
Human   123 NVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMKTAQAHRR 187

  Fly   250 AQTLLFSKHAVICQRDGTLSLMFRVGDMRKSHIIGAGVRAQLIRTKSTKEGEVMTQYFTELEIGT 314
            |:||:||:||||..|:|.|..||||||:|||.||.|.||.|:::..:|.||||:..:..::.:..
Human   188 AETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEVVPIHQLDIPVDN 252

  Fly   315 DDSGSDLFFIWPMVIEHKIDENSPLYNLNATDMLQDKFEIVVILEGTVESTGQSTQARSSYINTE 379
            ....:::|.:.|::|.|.||:.||||:::|||:.....|::|||||.||:||.:||||:|||..|
Human   253 PIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEE 317

  Fly   380 ILWGHRFDPVVLYNKDLQAYEIDYARFNETTQVDTPLCSARELNEIYKIQEGFRTPAETTFTMR- 443
            |.|||||  |.:..::...|.:||::|..|.:|..|.||||||:|         .|:....|:: 
Human   318 IQWGHRF--VSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE---------KPSILIQTLQK 371

  Fly   444 -QLSHNHS 450
             :|||.:|
Human   372 SELSHQNS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk2NP_001287485.1 IRK 100..434 CDD:279361 152/335 (45%)
KCNJ8NP_004973.1 IRK 37..184 CDD:395797 66/147 (45%)
Selectivity filter. /evidence=ECO:0000250 140..145 3/4 (75%)
IRK_C 191..363 CDD:407551 82/182 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..424 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3827
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59160
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.