DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irk2 and KCNJ3

DIOPT Version :9

Sequence 1:NP_001287485.1 Gene:Irk2 / 42770 FlyBaseID:FBgn0039081 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_002230.1 Gene:KCNJ3 / 3760 HGNCID:6264 Length:501 Species:Homo sapiens


Alignment Length:356 Identity:157/356 - (44%)
Similarity:226/356 - (63%) Gaps:11/356 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RRVRRRAVFKNGDCNVVQKHLQRRRVRFLQDMYTTMVDWQWRWTLLAFALSFILSWLFFALIWWL 157
            ::.|:|.|.|||.|||...:|.....|:|.|::||:||.:|||.|..|.|::.::|||.|.:||:
Human    40 KKKRQRFVDKNGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWV 104

  Fly   158 IIYTHGDLEEPHLPENQEESGWAPCVSAIDGFTSCFLFSIETQHTIGYGVRTTSPECPEAIFMMC 222
            |.||.|||.:.|:      ..:.|||:.:..|.|.|||.|||:.|||||.|..:.:|||.|.:..
Human   105 IAYTRGDLNKAHV------GNYTPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFL 163

  Fly   223 FQSIYGVMSSAFMAGIVFAKMTRAKQRAQTLLFSKHAVICQRDGTLSLMFRVGDMRKSHIIGAGV 287
            ||||.|.:..||:.|.:|.||::.|:||:||:||:||||..|||.|:||||||::|.||::.|.:
Human   164 FQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQI 228

  Fly   288 RAQLIRTKSTKEGEVMTQYFTELEIGTDDSGSDLFFIWPMVIEHKIDENSPLYNLNATDMLQDKF 352
            |.:|::::.|.|||.:.....||::|.......||.:.|:.|.|.||..||.|:|:...|..::|
Human   229 RCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQF 293

  Fly   353 EIVVILEGTVESTGQSTQARSSYINTEILWGHRFDPVVLYNKDLQAYEIDYARFNETTQVDTPLC 417
            ||||||||.||:||.:.|||:||...|:||||||.||:...:..  :::||::|:.|.:|.||..
Human   294 EIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGF--FKVDYSQFHATFEVPTPPY 356

  Fly   418 SARELNEIYKIQEGFRTPAETTFTMRQLSHN 448
            |.:|..|:..:......||.|....|   ||
Human   357 SVKEQEEMLLMSSPLIAPAITNSKER---HN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irk2NP_001287485.1 IRK 100..434 CDD:279361 149/333 (45%)
KCNJ3NP_002230.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 157/356 (44%)
IRK 47..187 CDD:395797 66/145 (46%)
Selectivity filter. /evidence=ECO:0000250 143..148 4/4 (100%)
IRK_C 194..364 CDD:407551 78/171 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147184
Domainoid 1 1.000 196 1.000 Domainoid score I3114
eggNOG 1 0.900 - - E1_KOG3827
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59160
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.