DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94h and Ir75b

DIOPT Version :9

Sequence 1:NP_651148.2 Gene:Ir94h / 42769 FlyBaseID:FBgn0039080 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster


Alignment Length:412 Identity:78/412 - (18%)
Similarity:140/412 - (33%) Gaps:140/412 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 IFINQLKDLQGYKIRVQPD----------------LSPPNSFSYRDRHGECQ-VGGFLWRIVENF 218
            :.|.::.|....|.|:|.|                |.....:.:|||..:.. .||.:..::.: 
  Fly   204 VSIKEIFDFMNSKYRIQLDTYARLGYQARQPLRDMLDCKFKYIFRDRWSDGNATGGMIGDLILD- 267

  Fly   219 SKSLKGDTQVLYPTWAKAKVSAAEYMIQFTRNGSSDIGVTTTMITFKHEERYRDYSYPMYDISWC 283
                            ||.::.|.::..|.|  :..:...|....|:....:|:           
  Fly   268 ----------------KADLAIAPFIYSFDR--ALFLQPITKFSVFREICMFRN----------- 303

  Fly   284 TMLPVEKPLSVEILFSHVLSPGS-------ALLLILAFILFFLIV---------PQLI-KCL--- 328
                 .:.:|..:..:..|.|.|       ||||:||..|.::..         |.|: .||   
  Fly   304 -----PRSVSAGLSATEFLQPFSGGVWLTFALLLLLAGCLLWVTFILERRKQWKPSLLTSCLLSF 363

  Fly   329 ------GITFRGRLIGMASRIFAL-----VMLCSSSAQLLSLLMSPPLHTRIKSFDDLLTSGLKI 382
                  |.....|.:|.....|||     :|....::.::|.|:..|:.:.|::...|..|.|.:
  Fly   364 GAGCIQGAWLTPRSMGGRMAFFALMVTSYLMYNYYTSIVVSKLLGQPIKSNIRTLQQLADSNLDV 428

  Fly   383 FGIRSELY---FLDGGFRAKYASAFHLTENPN--ELY-----DNRNYFNTSWAYT---------- 427
             ||...:|   :::            .:|.|:  :||     .::...:..|..|          
  Fly   429 -GIEPTVYTRIYVE------------TSEEPDVRDLYRKKVLGSKRSPDKIWIPTEAGVLSVRDQ 480

  Fly   428 -----ITSVKWNVIEAQQRHF-AHPVFRYSTDLCFSSETP------WGLLIAPESFYREPLQHFT 480
                 ||.|... .|..::|| ||       .:|..:|.|      ...::|..|.|.|.::...
  Fly   481 EGFVYITGVATG-YEFVRKHFLAH-------QICELNEIPLRDASHTHTVLAKRSPYAELIKLSE 537

  Fly   481 LKINQAGL----ITQWMTQSFH 498
            |::.:.|:    ...||....|
  Fly   538 LRMLETGVHFKHERSWMETKLH 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94hNP_651148.2 None
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 65/355 (18%)
Lig_chan 343..585 CDD:278489 47/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.